Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0118
         (568 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative (CH...    30   0.94 

>At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative
           (CHX11) monovalent cation:proton antiporter family 2
           (CPA2) member, PMID:11500563
          Length = 671

 Score = 30.3 bits (65), Expect = 0.94
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = -2

Query: 153 RKSYKTTY*RFNKNETTLFKGGN*LRKLLTLV*YFR-NRRLRV*TVHII 10
           RKSY T+  R+N +   LF GG   R+ L+LV   + N R+RV  + +I
Sbjct: 513 RKSYVTSKNRYNIDVGVLFIGGKDDREALSLVKRMKYNPRVRVTVIRLI 561


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,115,710
Number of Sequences: 28952
Number of extensions: 165947
Number of successful extensions: 286
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 286
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1092379416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)