BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0116 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 25 0.40 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.1 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 4.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.9 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 4.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.9 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 25.4 bits (53), Expect = 0.40 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 420 CPPIYRPRCRLS 455 CPPIY P C+ S Sbjct: 33 CPPIYEPSCQYS 44 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 280 LYIMLIGKSLSWDRSRWRYLIRN 212 L + I KS WD +WR L N Sbjct: 93 LTTVTIFKSAFWDVDKWRTLFTN 115 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 327 LSLIFHRIQSMQGLHRHP 380 +SL H+I SM H HP Sbjct: 349 MSLTRHQISSMGHSHAHP 366 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 182 SPVGTPQPPAIPNQVSPPGPIPTQTFTNQHYV 277 SPVG PP +P + +P QT Y+ Sbjct: 119 SPVGVALPPTLP-AAAAAALLPPQTAAMAAYL 149 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 327 LSLIFHRIQSMQGLHRHP 380 +SL H+I SM H HP Sbjct: 349 MSLTRHQISSMGHSHAHP 366 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 593 VFFIGHGRNRRKYLLAER 540 V ++ GRN RKY + ER Sbjct: 193 VGYVVEGRNYRKYRVEER 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,502 Number of Sequences: 336 Number of extensions: 2644 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -