BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0114 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43687| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_22879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_43687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 199 FKINNMI--KVIKRYTKKIKEDIVPKYNYKYTSGKRIA 306 FKI ++I KV+++ T K+ VP Y+ SG+ +A Sbjct: 262 FKIKDVIDVKVLRKITPDTKDGFVPVLQYRKESGRTVA 299 >SB_22879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 269 NIIINIPLVNELLIICNYFLNYVNIFTVCNQLILI 373 NIIINI ++N ++II N +N + I + N +I+I Sbjct: 16 NIIINIIIIN-IIIIINIIINII-IIIIINIIIII 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,390,687 Number of Sequences: 59808 Number of extensions: 336357 Number of successful extensions: 557 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -