Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0112
         (407 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL021346-3|CAI79189.1|  175|Caenorhabditis elegans Hypothetical ...    29   1.7  
U40059-5|AAA81140.1|  191|Caenorhabditis elegans Hypothetical pr...    28   2.3  

>AL021346-3|CAI79189.1|  175|Caenorhabditis elegans Hypothetical
           protein H37A05.4 protein.
          Length = 175

 Score = 28.7 bits (61), Expect = 1.7
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 6/46 (13%)
 Frame = -1

Query: 215 ESRLTEKIR*ENQWALI------VMNLIFFFLEHCFAFYIFLILSK 96
           ES  +E  R   +W  I      + NLIFFF    F+F+   IL+K
Sbjct: 128 ESEYSENERRRKRWRRIGMDGWRIQNLIFFFFSDNFSFFFNCILNK 173


>U40059-5|AAA81140.1|  191|Caenorhabditis elegans Hypothetical
           protein K03C7.3 protein.
          Length = 191

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -1

Query: 149 FFFLEHCFAFYIF 111
           FFFL HCFAF  F
Sbjct: 130 FFFLRHCFAFLFF 142


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,199,022
Number of Sequences: 27780
Number of extensions: 141525
Number of successful extensions: 254
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 247
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 254
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 651753158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)