BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0110 (573 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces p... 28 0.84 SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosacch... 25 6.0 >SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 28.3 bits (60), Expect = 0.84 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 366 DNKKESISVCVCQIRGNVCNAFIIDL 289 D KK + + C GN CN ++DL Sbjct: 66 DMKKPQVGIASCWYEGNPCNMHLLDL 91 >SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 468 Score = 25.4 bits (53), Expect = 6.0 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = -2 Query: 533 KLLICTLLRFYCQRLLIILP*SQIAPNITIW 441 +L++ ++L C+RL ++ + P+I W Sbjct: 329 RLIVFSILTLVCRRLPVVFSVKPLVPDIKTW 359 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,138,210 Number of Sequences: 5004 Number of extensions: 39120 Number of successful extensions: 62 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -