BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0109 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 28 0.21 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 27 0.48 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 26 0.84 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 2.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 3.4 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 24 3.4 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 3.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 3.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 4.5 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 23 7.9 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 27.9 bits (59), Expect = 0.21 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 324 PNNYQYNGHPNRFGNQGHGYTPGYFGNGYRFRTSLTGTIYGG 449 PNNY+Y + N + +Q F +GY R ++ YGG Sbjct: 711 PNNYEYERNQNIYNSQFKVEYSDNFNSGYGLRNAV---FYGG 749 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 26.6 bits (56), Expect = 0.48 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 267 SQSQSSANEGGGYNRHGY--YPNNYQYNGHPNRFGNQGH 377 S S GGGY+R Y +Y+ NG +++G+ H Sbjct: 595 SDSGKVGGGGGGYDRDDYRRTEKDYRGNGKHDKYGSSRH 633 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.8 bits (54), Expect = 0.84 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 Query: 470 PKGIPSITTVNSSR*TGTEPVAVPKVSWCVAVPLVTETV 354 P +P + VN G EPV P SW + P VTE V Sbjct: 615 PYVLPRASEVNDFFYGGLEPV--PLASWQLPPPYVTEPV 651 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 326 WVISMAIVTTAFVSRRLRLANGYVDGIAPVMS 231 W + I TTA+ +A Y+DGI PVM+ Sbjct: 1064 WGTTNQIETTAYALLSFVMAEKYLDGI-PVMN 1094 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 76 LNSSPAEHPDDPE 38 L S P EHP DPE Sbjct: 492 LCSCPCEHPSDPE 504 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 23.8 bits (49), Expect = 3.4 Identities = 15/60 (25%), Positives = 23/60 (38%) Frame = +1 Query: 238 TGAIPST*PLANRSLLLTKAVVTIAMDITQTTISIMDILTVSVTKGTATHQDTLGTATGS 417 T P+T +A + + T T TT++ T +V G T + T T S Sbjct: 27 TTVAPATTTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVASGPVTTTGSTDTTTPS 86 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 315 GYYPNNYQYN-GHPNRFGN 368 G+YP+NYQ+ HP G+ Sbjct: 26 GWYPSNYQHQPPHPQFIGD 44 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 3.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 470 PKGIPSITTVNSSR*TGTEPVAVPKVSWCVAVPLVTETV 354 P +P + VN +EPV P SW + P +TE V Sbjct: 614 PYVLPRASEVNDFFYGASEPV--PLASWPLPPPYITEPV 650 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 160 LDYVKNMEDTKGTKAM 207 LDYV+N +D G+KA+ Sbjct: 921 LDYVRNNKDKIGSKAL 936 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 155 KAWTMSRIWRIPRAPRLW 208 +AW ++ R RAPR W Sbjct: 26 RAWQYRQMTRFHRAPRPW 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,133 Number of Sequences: 2352 Number of extensions: 11950 Number of successful extensions: 28 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -