BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0108 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0684 - 5071994-5072134,5072240-5072365,5072452-5072608,507... 31 0.58 06_03_0824 + 25105450-25105482,25105649-25106485,25106580-251067... 31 1.0 04_01_0184 - 2085271-2085387,2085642-2085730,2086582-2086813,208... 31 1.0 03_02_0225 + 6565337-6565369,6565564-6565734,6566113-6566400,656... 31 1.0 02_05_0418 + 28807763-28807777,28809216-28809242,28809588-288096... 31 1.0 04_04_0340 + 24517562-24520318 30 1.3 04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-70... 30 1.3 01_01_0012 + 71903-72935,73468-73981,74619-76008 30 1.3 10_05_0072 + 8839223-8839720 30 1.8 04_03_0635 + 18215241-18215489 30 1.8 03_02_0178 + 6195402-6199158,6199438-6200003 30 1.8 04_04_0179 - 23342764-23342973,23343185-23343340,23343535-233435... 29 2.3 02_02_0284 - 8547126-8547187,8547306-8547395,8547810-8547861,854... 29 2.3 10_08_0938 + 21693629-21694360,21694558-21694613,21694836-21694869 29 3.1 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 29 4.1 05_05_0154 - 22774503-22774652,22774738-22774968,22775508-227756... 29 4.1 05_01_0356 + 2785410-2785670,2785843-2785960,2786800-2786891,278... 29 4.1 12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817,164... 28 5.4 11_01_0216 + 1693889-1694897,1695034-1695149,1695222-1695389,169... 28 5.4 06_01_0882 + 6759378-6759707,6759837-6760488,6760609-6760673,676... 28 5.4 03_06_0677 + 35476009-35476014,35476974-35477474,35477574-354777... 28 5.4 03_06_0239 - 32578231-32578353,32578431-32578655,32579081-325792... 28 5.4 03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407... 28 5.4 03_05_0739 + 27271404-27271988,27272265-27272411 28 5.4 11_06_0212 - 21319441-21319498,21319737-21319867,21319944-213200... 28 7.1 07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120,332... 28 7.1 06_03_0833 - 25196091-25196372,25196464-25196565,25196640-251968... 28 7.1 03_05_1090 + 30313176-30313292,30314162-30314236,30314938-303151... 28 7.1 01_05_0264 + 20168409-20168593,20168726-20169055,20170142-201706... 28 7.1 09_04_0376 + 17077737-17078447 27 9.4 06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910,152... 27 9.4 01_05_0309 - 20713774-20713818,20713838-20713915,20714044-207142... 27 9.4 >02_01_0684 - 5071994-5072134,5072240-5072365,5072452-5072608, 5073115-5073224,5073309-5073456,5073581-5073735, 5074144-5074249,5074337-5074436,5074775-5074880, 5075013-5075444 Length = 526 Score = 31.5 bits (68), Expect = 0.58 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 385 TDLFRKMDKDNNGLIPRNEFIDGIVNTKFDT 477 T LF K+DK+N G + R+ FID +N+ T Sbjct: 197 TVLFGKIDKENTGFVTRDAFIDFWLNSNMVT 227 >06_03_0824 + 25105450-25105482,25105649-25106485,25106580-25106738, 25106830-25106886,25106971-25107202,25107338-25107638, 25107703-25107976,25108051-25108152,25108244-25108525 Length = 758 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 193 PALHLCFPSAGIGVRSGAGS 134 P LHLC P+AG V G GS Sbjct: 9 PTLHLCSPAAGANVSGGGGS 28 >04_01_0184 - 2085271-2085387,2085642-2085730,2086582-2086813, 2086898-2086990,2087046-2087204,2087298-2088134, 2088353-2088385 Length = 519 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 193 PALHLCFPSAGIGVRSGAGS 134 P LHLC P+AG V G GS Sbjct: 9 PTLHLCSPAAGANVSGGGGS 28 >03_02_0225 + 6565337-6565369,6565564-6565734,6566113-6566400, 6566495-6566653,6566745-6566801,6566886-6567117, 6567253-6567553,6567618-6567891,6567966-6568067, 6568159-6568440 Length = 632 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 193 PALHLCFPSAGIGVRSGAGS 134 P LHLC P+AG V G GS Sbjct: 9 PTLHLCSPAAGANVSGGGGS 28 >02_05_0418 + 28807763-28807777,28809216-28809242,28809588-28809621, 28809909-28810154,28810518-28810948,28812759-28813418 Length = 470 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 115 GRETPDRNLPHYGPRFPPKGSKGAEPEFRSPRVKQLWD 228 G+E P +++P + PRFP K EP+ W+ Sbjct: 377 GKEPPPKHVPRWLPRFPDKPEPEPEPKAAYDEATARWE 414 >04_04_0340 + 24517562-24520318 Length = 918 Score = 30.3 bits (65), Expect = 1.3 Identities = 28/101 (27%), Positives = 47/101 (46%) Frame = +1 Query: 106 ISPGRETPDRNLPHYGPRFPPKGSKGAEPEFRSPRVKQLWDRWRNVWLLAWERQRRLHER 285 IS +P PH P P G + + E R + +L W + L + ++L+ Sbjct: 789 ISTHGSSPSHAAPHAMPCVLPLGLE--KLELRCFPLVEL-PHWVSPEKL--RKLKKLYIS 843 Query: 286 LAHLKELQRVSNFSWDDWRKRFLKFMNHKKSRLTDLFRKMD 408 ++ +L + ++ R RFLK MN+ + L D FRK+D Sbjct: 844 GGNISDLGDLKSWEVTVLRLRFLKHMNYSWTALHDSFRKLD 884 >04_01_0070 - 706640-706747,707221-707307,707397-707502,707585-707693, 707766-708145,708508-708601,709351-709475,709633-709674, 710822-710892,710979-711060,711157-711277,712404-712713 Length = 544 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 97 FSRISPGRETPDRNLPHYGPRFPPKGSKGAEPEFRSPRVKQLWDR 231 F R++P P L P FPPK + P FRS R ++ +R Sbjct: 26 FFRLTPAASAPPFLLDLASPPFPPKNPRPDFPLFRSCRTVKVGNR 70 >01_01_0012 + 71903-72935,73468-73981,74619-76008 Length = 978 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Frame = -2 Query: 569 GSAAMNS-FPV-----DEAATVPVETDPPRRPSPAGDVSNLV-LTMPSMNSFLG 429 GS M S FPV + AATV T PP P+ + N+V TMP+M ++ G Sbjct: 173 GSPVMGSPFPVFFSASNTAATVVTSTFPPTLPAVSSAYPNMVNQTMPNMPNYAG 226 >10_05_0072 + 8839223-8839720 Length = 165 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 584 STQSGGSAAMNSFPVDEAATVPVETDPPRRPSPA 483 S+ SGG+A D AA P +PP+ P+PA Sbjct: 77 SSGSGGAAPPPPAAGDAAAPKPAAEEPPKEPAPA 110 >04_03_0635 + 18215241-18215489 Length = 82 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -1 Query: 144 GQVPIWRLPSRA--DTTESSRSVVVGRDRAV 58 G +WR P+R+ D T+SSR V++GR R++ Sbjct: 35 GYGDVWRQPARSAMDRTKSSRCVLLGRARSL 65 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 613 CPHRSGVRGVPPSQGEAPQ*TPSQSMRPLPFLSKQ 509 C + G+P S +AP PS ++ +PFL KQ Sbjct: 1271 CNIAERIDGIPSSSRKAPSWLPSVTLEGVPFLEKQ 1305 >04_04_0179 - 23342764-23342973,23343185-23343340,23343535-23343593, 23344150-23344226,23344309-23344587,23344800-23344885, 23344960-23345027,23345721-23345904,23346071-23346204, 23346776-23347039,23347613-23347677,23347833-23348407, 23348501-23348680,23348765-23348928,23349008-23349261, 23349405-23349562,23349808-23349948,23350176-23350282, 23350651-23350737,23350812-23350901,23350974-23351055, 23351370-23351561,23351748-23351816,23351959-23352294, 23352694-23352837,23352963-23353126,23353817-23353883 Length = 1463 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 343 KRFLKFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGIVNTKFDTS 480 K F + ++++ L RKM KD NG + E I+ I + +TS Sbjct: 248 KEFTILLASHRNQVRSLLRKMMKDENGAHSKQELIEVISKSMKETS 293 >02_02_0284 - 8547126-8547187,8547306-8547395,8547810-8547861, 8548209-8548284,8550513-8550632,8553334-8553423, 8553842-8554024,8554125-8554185,8554437-8554477, 8554563-8554727,8555699-8555776,8556137-8556282 Length = 387 Score = 29.5 bits (63), Expect = 2.3 Identities = 19/68 (27%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = +1 Query: 13 HEGTPGRGSQHDLHRDRSVSPDYYGSRRFSRISPGRETPDRNLPH--YGPRFPPKGSKGA 186 + +P R H R ++ ++ SP + DR Y R PP S G+ Sbjct: 176 YSASPQRKDTHRAKSPRRQPKEHEVDKKRRSYSPANKDGDRRDADNGYEKRSPPADSDGS 235 Query: 187 EPEFRSPR 210 P RSPR Sbjct: 236 PPHRRSPR 243 >10_08_0938 + 21693629-21694360,21694558-21694613,21694836-21694869 Length = 273 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -2 Query: 590 RRSTQSGGSAAMNSFPVDEAATVPVETDPPRRPSPAGDVS 471 R + Q GS A+ +FP + AA V+ PP P PA +S Sbjct: 132 RAAFQLRGSKAILNFPNEVAADAAVKWAPPVAPIPAAAMS 171 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 379 RLTDLFRKMDKDNNGLIPRNEFI 447 RL D+ ++D+DN+G I NEF+ Sbjct: 561 RLEDMIGEVDQDNDGRIDYNEFV 583 >05_05_0154 - 22774503-22774652,22774738-22774968,22775508-22775675, 22775760-22775936,22776281-22776302,22776351-22776417, 22776583-22776774,22776819-22776962,22778421-22779102 Length = 610 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +1 Query: 289 AHLKELQRVSNFSWDDWRKRFLKFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGI 456 + LK+ R++ F R + + D+F+ MD DN+G++ E GI Sbjct: 411 SRLKQFSRMNRFKRRALRVIADHLSAEEVEDIKDMFKVMDTDNDGIVSYEELKSGI 466 >05_01_0356 + 2785410-2785670,2785843-2785960,2786800-2786891, 2787114-2787176,2787299-2787397,2787726-2787884, 2788420-2788491,2788567-2788699,2788813-2788877, 2789016-2789091,2789236-2789337,2789524-2789716, 2790576-2790654,2792939-2793007,2793261-2793311, 2793680-2793742,2793926-2794041,2794263-2794347, 2794898-2794957,2795594-2795639,2796011-2796084, 2796350-2796400,2796474-2796674,2796747-2796791, 2797063-2797156,2797226-2797371,2797510-2797739, 2798136-2798196,2798290-2798347,2799020-2799513 Length = 1151 Score = 28.7 bits (61), Expect = 4.1 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +1 Query: 286 LAHLKELQRVSNFSWDDWRKRFLKFMNHKKSRLTDLFRKMDKDNNGLIPR---NEFIDGI 456 L L EL + S D + F R+ D+F +DKD NG + + E+ DG Sbjct: 346 LQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLALDKDTNGTLSKQELKEYADGT 405 Query: 457 VNTKF 471 + F Sbjct: 406 LTDIF 410 >12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817, 1648911-1649038,1649121-1649220,1649329-1649433 Length = 541 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 382 LTDLFRKMDKDNNGLIPRNEFIDGIV--NTKF 471 L ++F+ +DKDN+G I E +G+ TKF Sbjct: 389 LKEMFKNIDKDNSGTITLEELKNGLAKQGTKF 420 >11_01_0216 + 1693889-1694897,1695034-1695149,1695222-1695389, 1695482-1695609,1695692-1695791,1696124-1696168 Length = 521 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 382 LTDLFRKMDKDNNGLIPRNEFIDGIV--NTKF 471 L ++F+ +DKDN+G I E +G+ TKF Sbjct: 389 LKEMFKNIDKDNSGTITLEELKNGLAKQGTKF 420 >06_01_0882 + 6759378-6759707,6759837-6760488,6760609-6760673, 6761363-6761440,6761523-6761633,6761739-6761783, 6762200-6762373,6762841-6763797 Length = 803 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -2 Query: 611 SASVGGPRRSTQSGGSAAMNSFPVDEAATVPVETDPPRRPSP 486 SAS GGPRR G +A A + + PP RP P Sbjct: 19 SASRGGPRRGRVVGVAAPPALLYDGRAGRLALRAPPPPRPRP 60 >03_06_0677 + 35476009-35476014,35476974-35477474,35477574-35477762, 35477925-35477945 Length = 238 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 22 TPGRGSQHDLHRDRSVSPDYYGSRRFSRISPGRETPDRN--LPHYG 153 +P R + L +R +P G +F G ETPDR +P +G Sbjct: 135 SPSRDRRGSLEGNRGSAPTTPGRSKFRSTGRGDETPDRGSAVPKFG 180 >03_06_0239 - 32578231-32578353,32578431-32578655,32579081-32579248, 32579331-32579446,32579540-32579692,32579779-32579922, 32580775-32581576 Length = 576 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +1 Query: 376 SRLTDLFRKMDKDNNGLIPRNEFID 450 +R+ D+ +D+DN+G I NEF++ Sbjct: 523 TRIEDIIGDIDQDNDGRIDYNEFVE 547 >03_06_0235 + 32539025-32539886,32540330-32540473,32540595-32540747, 32540871-32540986,32541254-32541421,32541534-32541758, 32541884-32542015 Length = 599 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +1 Query: 379 RLTDLFRKMDKDNNGLIPRNEFI 447 +L ++ R++D+DN+G I NEF+ Sbjct: 544 QLEEMIREVDEDNDGRIDYNEFV 566 >03_05_0739 + 27271404-27271988,27272265-27272411 Length = 243 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 382 LTDLFRKMDKDNNGLIPRNEFIDGI 456 + D+F MD DNNG + E DG+ Sbjct: 53 IKDMFALMDTDNNGRVTLQELKDGL 77 >11_06_0212 - 21319441-21319498,21319737-21319867,21319944-21320033, 21320141-21320298,21320646-21320721 Length = 170 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 373 KSRLTDLFRKMDKDNNGLIPRNE 441 + L FR DKD+NG I RNE Sbjct: 86 EEELRKAFRIFDKDDNGFISRNE 108 >07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120, 3323207-3323322,3323394-3323546,3323655-3323798, 3324475-3325255 Length = 568 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 376 SRLTDLFRKMDKDNNGLIPRNEFI 447 + L D+ + +D+DN+G I NEF+ Sbjct: 516 AHLEDIIKDIDQDNDGRIDYNEFV 539 >06_03_0833 - 25196091-25196372,25196464-25196565,25196640-25196838, 25196978-25197278,25197471-25197645,25197842-25198012, 25198207-25198239 Length = 420 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 187 LHLCFPSAGIGVRSGAGS 134 LHLC P+AG V G GS Sbjct: 11 LHLCSPAAGANVSGGGGS 28 >03_05_1090 + 30313176-30313292,30314162-30314236,30314938-30315181, 30315701-30315787,30315832-30315995,30316587-30316689, 30317751-30317908,30318025-30318105,30318192-30318344 Length = 393 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 382 LTDLFRKMDKDNNGLIPRNEFIDGIVNTKFDTSPAGDG 495 L D+ R++D D NG+I EF+ I D GDG Sbjct: 287 LNDMMREVDTDGNGIIDFQEFLSLIARKMKD----GDG 320 >01_05_0264 + 20168409-20168593,20168726-20169055,20170142-20170670, 20170825-20170958,20171080-20171252,20171274-20171840, 20172487-20172716,20172954-20172995,20173096-20173224 Length = 772 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 193 EFRSPRVKQLWDRWRNVWLLAWERQRRLHERL 288 +++ V L D+ R L+ W+++RR+ ERL Sbjct: 607 DYKDLHVVDLADKIRETILILWDKRRRIGERL 638 >09_04_0376 + 17077737-17078447 Length = 236 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 599 GGPRRSTQSGGSAAMNSFPVDEAATVPVETDP 504 G P+ S+ S S AM AA PVE DP Sbjct: 103 GAPQGSSSSSSSEAMREMIFHIAALQPVEIDP 134 >06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910, 1522246-1522358,1522432-1522642,1523087-1523133, 1523211-1523369,1523521-1523624,1524300-1524634 Length = 416 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 611 SASVGGPRRSTQSGGSA-AMNSFPVDEAATVPVETDPPRRPS 489 S GG ++ SGGS S D A VP+ PP PS Sbjct: 371 SGGGGGEHEASNSGGSEKGYGSIDPDAGAVVPLYYAPPFAPS 412 >01_05_0309 - 20713774-20713818,20713838-20713915,20714044-20714222, 20714296-20714556,20715222-20715393,20715501-20715662, 20716435-20716863,20717729-20717785,20717872-20718842, 20719098-20719182,20719269-20719637,20719756-20720001, 20720090-20720362,20720663-20720827,20721328-20721556, 20721727-20722168,20723152-20724138,20724352-20724517, 20725070-20725728,20725820-20726186 Length = 2113 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 294 MGEALVQPPLALPGEQPHVAPPVP 223 MGE PPL L PH+ PP P Sbjct: 1 MGEPDELPPLPLALHPPHLIPPAP 24 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,069,693 Number of Sequences: 37544 Number of extensions: 460846 Number of successful extensions: 2441 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2437 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -