BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0108 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08) 36 0.036 SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) 33 0.26 SB_46593| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_11877| Best HMM Match : efhand (HMM E-Value=7.8e-07) 31 0.59 SB_2973| Best HMM Match : efhand (HMM E-Value=2e-09) 31 0.59 SB_693| Best HMM Match : efhand (HMM E-Value=2e-09) 31 0.59 SB_59115| Best HMM Match : Spectrin (HMM E-Value=0) 31 0.78 SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31) 30 1.8 SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_49426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_22780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_10060| Best HMM Match : SAP (HMM E-Value=0.016) 29 3.2 SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 29 4.2 SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) 29 4.2 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 29 4.2 SB_10444| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 29 4.2 SB_13432| Best HMM Match : Reticulon (HMM E-Value=5.1e-16) 29 4.2 SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) 29 4.2 SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) 28 5.5 SB_15862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_23274| Best HMM Match : DUF624 (HMM E-Value=9.3) 28 7.3 SB_16160| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_27251| Best HMM Match : Extensin_2 (HMM E-Value=0.077) 27 9.7 SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) 27 9.7 SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) 27 9.7 SB_4764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 101 bits (243), Expect = 4e-22 Identities = 53/147 (36%), Positives = 81/147 (55%), Gaps = 2/147 (1%) Frame = +1 Query: 202 SPRVKQLWDRWRNVWLLAWERQRRLHERLAHLKELQRVSNFSWDDWRKRFLKFMNHKKSR 381 +P V L RW+++WLL+ ER RRL E+L + + + F++ +W+ RF K+++ KSR Sbjct: 5977 NPAVSHLSKRWQHLWLLSMERLRRLQEKLERIAIKRASAKFNFPEWKSRFNKWLHDSKSR 6036 Query: 382 LTDLFRKMDKDNNGLIPRNEFIDGIVNTKFDTSPAGDGRRXXXXXXXXXXXXXXXKEFIA 561 + D+FR+MD D +G + R +FI G++NT F P KEF+ Sbjct: 6037 VQDIFRRMDHDRDGKLTREQFITGVLNTSF---PTERWEMEIVASKFERNGLIDYKEFMN 6093 Query: 562 AL--PPDWVERRGPPTDADKIHDEVKR 636 AL P + P TDA KIH+E+ R Sbjct: 6094 ALKDKPSAKKPEKPKTDAQKIHNEIDR 6120 >SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08) Length = 676 Score = 35.5 bits (78), Expect = 0.036 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 7/52 (13%) Frame = +1 Query: 322 FSWDDWRKRFLKFMNHKKS-------RLTDLFRKMDKDNNGLIPRNEFIDGI 456 FS D +K+ L+ +N K RL DLF + DKDN+ + R+EF G+ Sbjct: 580 FSGDTKKKKILELINMLKEYVERMNYRLVDLFNQFDKDNSLSVTRDEFYTGL 631 >SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) Length = 520 Score = 32.7 bits (71), Expect = 0.26 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 355 KFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGIVNT 465 ++++ ++ RL DLF + DKD N ++ R EF + I +T Sbjct: 177 EYLDQRRLRLVDLFAQADKDKNWVVTRVEFRNIIRST 213 >SB_46593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 31.9 bits (69), Expect = 0.45 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 1/81 (1%) Frame = +1 Query: 112 PGRETPDRNLPHYGPRFP-PKGSKGAEPEFRSPRVKQLWDRWRNVWLLAWERQRRLHERL 288 P E D N+ Y F P G PEF + KQ D W ++ LA E+ Sbjct: 361 PSEEVFDTNIYAYTLEFAMPNIYSGLTPEFLDGK-KQGADEWTSIPTLADALGTDYMEKA 419 Query: 289 AHLKELQRVSNFSWDDWRKRF 351 A + V N WDD + +F Sbjct: 420 AERAKQFFVRNNDWDDSKNKF 440 >SB_11877| Best HMM Match : efhand (HMM E-Value=7.8e-07) Length = 390 Score = 31.5 bits (68), Expect = 0.59 Identities = 19/73 (26%), Positives = 36/73 (49%) Frame = +1 Query: 280 ERLAHLKELQRVSNFSWDDWRKRFLKFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGIV 459 + LA L E S + + ++ L++ RL D+F++ D DN+G + +EF G+ Sbjct: 255 QELADLAEELCNSAKRFSAFPEKMLEWFTFNYYRLIDVFKRFDTDNSGKLSYDEFFLGMQ 314 Query: 460 NTKFDTSPAGDGR 498 + T+ + R Sbjct: 315 DLALFTTDSRRSR 327 >SB_2973| Best HMM Match : efhand (HMM E-Value=2e-09) Length = 508 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 358 FMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGI 456 ++ + R+ DLFR++DKD + + EF++G+ Sbjct: 420 YLAREHVRVVDLFRRLDKDQSMQVSVREFVEGL 452 >SB_693| Best HMM Match : efhand (HMM E-Value=2e-09) Length = 500 Score = 31.5 bits (68), Expect = 0.59 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +1 Query: 358 FMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGI 456 ++ + R+ DLFR++DKD + + EF++G+ Sbjct: 412 YLAREHVRVVDLFRRLDKDQSMQVSVREFVEGL 444 >SB_59115| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1457 Score = 31.1 bits (67), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +1 Query: 187 EPEFRSPRVKQLWDRWRNVWLLAWERQRRLHERLAHLKELQRVSNFSWDDWRKRFL 354 E E R + L +RW ++ + + ERQ LHE+L L++ Q W D ++ + Sbjct: 554 ENEIRDQMIS-LNERWESLRITSMERQTSLHEQLMSLQQRQIDQLAEWLDKAEKII 608 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 30.3 bits (65), Expect = 1.4 Identities = 24/103 (23%), Positives = 47/103 (45%) Frame = +1 Query: 133 RNLPHYGPRFPPKGSKGAEPEFRSPRVKQLWDRWRNVWLLAWERQRRLHERLAHLKELQR 312 ++L G + + A+ E R+K + RWRN+ LA +R ++L K L Sbjct: 713 KDLQTRGVTAAKEATSRADQESLENRLKDIVQRWRNINKLAGDRSKKLE------KLLPV 766 Query: 313 VSNFSWDDWRKRFLKFMNHKKSRLTDLFRKMDKDNNGLIPRNE 441 V N+ +R L +++ + RL +L + N ++ + + Sbjct: 767 VMNYV--QYRNNLLAWLSADEKRLQELALNDEVSNMDVLSQKQ 807 >SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 373 KSRLTDLFRKMDKDNNGLIPRNEFIDGIVNTK 468 + LT LF ++D+D +G + NEF+ G+ K Sbjct: 274 EQELTLLFEELDEDGDGKVSFNEFLHGLFAAK 305 >SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31) Length = 156 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 367 HKKSRLTDLFRKMDKDNNGLIPRNEF 444 HK + ++F+K DKD +G I R EF Sbjct: 91 HKIRKAIEMFKKYDKDASGSIDREEF 116 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +1 Query: 262 RQRRLHERLAHLKELQRVSNFSWDDWRKRFLKFMNH--KKSRLTDLFRKMDKDNNGLIPR 435 R ++ + + K+ + ++ S D R+ F + M+ K + +K+DKD NG I Sbjct: 89 RYHKIRKAIEMFKKYDKDASGSID--REEFKQLMHETGNKVNIDKALKKLDKDGNGQISF 146 Query: 436 NEFI 447 EF+ Sbjct: 147 TEFL 150 >SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 391 LFRKMDKDNNGLIPRNEFIDGI 456 +FR DK+N+G I NEFI G+ Sbjct: 71 VFRTFDKNNDGTIDFNEFIQGL 92 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 29.5 bits (63), Expect = 2.4 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = -2 Query: 605 SVGGPRRSTQSGGSAAMNS---FPVDEAATVPVETDPPRRPSP--AGDVSNLVLTMPSM 444 S GG T S GS+ M S P + VP+ PRRP P A + ++ + T PS+ Sbjct: 2012 SEGGGSTGTPSVGSSRMASDMGLPNISRSPVPIVPSQPRRPVPRNARNANSPITTTPSV 2070 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/67 (29%), Positives = 31/67 (46%) Frame = +1 Query: 88 SRRFSRISPGRETPDRNLPHYGPRFPPKGSKGAEPEFRSPRVKQLWDRWRNVWLLAWERQ 267 SR SR +P R TP R R P + + + ++P++ LW R + V +E Sbjct: 249 SRTSSRTTPARATPSRK----SSRTPSQTPRSQQR--KTPKLDLLWTRKQGVMYNLFEWP 302 Query: 268 RRLHERL 288 R H +L Sbjct: 303 SRRHSKL 309 >SB_49426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +1 Query: 184 AEPEFRSPRVKQLWDRWRNVWLLAWERQRRLHERLAHLKELQRVS 318 +EPE R+ R Q+W + ++ +RQ RL ++ +++RV+ Sbjct: 51 SEPECRAQRESQVWTKAFTIYYKGGKRQGRLLDKNGRQYQVKRVT 95 >SB_22780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 1 SEERHEGTPGRGSQHDLHRDRSVSPDYYGSRRFSRISPGRETPDR 135 S+ H G PG G D++ V PD+ G RI E+ D+ Sbjct: 69 SQNAHYGRPGSGYIIDINGQILVKPDFNGGHLGYRIETQTESRDK 113 >SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 364 NHKKSRLTDLFRKMDKDNNGLIPRNEFIDGIVNTK 468 N + + ++ ++D D NG++ NEF+D + N K Sbjct: 180 NPTEEEIQEMVNEVDYDGNGVLDFNEFVDLMENQK 214 >SB_10060| Best HMM Match : SAP (HMM E-Value=0.016) Length = 332 Score = 29.1 bits (62), Expect = 3.2 Identities = 27/84 (32%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +1 Query: 16 EGTPGRGSQHDLHRDRSVSPDYYGS-RRFSRISPGRETPDRNLPHYGPRFPPKGSKGAEP 192 EGTPG S L DR + G R I PD NL H GP F + +K +E Sbjct: 169 EGTPGSASPLGL--DRPLDEALEGKITRGEHIDLALLLPD-NLAHAGPEFQLRFAKNSES 225 Query: 193 EFRSPRVKQLWDRWRNVWLLAWER 264 +Q D + W++A+ R Sbjct: 226 VRLLRNKRQSIDSFYK-WVIAYTR 248 >SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -3 Query: 238 CATGPTAASRGAT*TPALHLCFPSAGIGVRSGAGSDLA 125 C+TG RG T C PSA +G+ SGA SD A Sbjct: 109 CSTGKKCVLRGEGMTHKCEDCLPSA-MGMESGAISDSA 145 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/75 (29%), Positives = 29/75 (38%) Frame = -1 Query: 303 FLEMGEALVQPPLALPGEQPHVAPPVPQLLHAGRPELRLCTFASLRRESGSVVGQVPIWR 124 FLE GE V PPL G + P + LC RR + +G V W Sbjct: 459 FLEGGETAVCPPLPGGGTAERLPPRQSAPSRSMAITSLLCGSTFERRTTVLSMGVVSDWS 518 Query: 123 LPSRADTTESSRSVV 79 +P+ + T R V Sbjct: 519 IPATSPYTTEQRHEV 533 >SB_37499| Best HMM Match : 7tm_1 (HMM E-Value=4e-09) Length = 378 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 129 RSEPAPLRTPIPAEGKQRCRAGVQVAPR 212 RS PA LRT + +G R GV+ PR Sbjct: 256 RSRPATLRTVLGGDGADRAPRGVRPGPR 283 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +1 Query: 10 RHEGTPGRGSQHDLHRDRSVSPDYYGSRRFSRISPGRETPDRNLPHYGPRFPP 168 RH+ P R RD YY R R P R+ P R Y +PP Sbjct: 239 RHDLPPPRDPYDRERRDPYERDPYYDHRDDPRDDPRRDDPYRRYDDYPRDYPP 291 >SB_10444| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 263 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 590 RRSTQSGGSAAMNSFPVDEAATVPVETDPPRRPSPA 483 R++ Q G AA V +A VPV P R P PA Sbjct: 151 RKTGQDAGQAAHPKKAVSPSAAVPVSKIPRRSPLPA 186 >SB_13432| Best HMM Match : Reticulon (HMM E-Value=5.1e-16) Length = 621 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 542 VDEAATVPVETDPPRRPSPAGDVSNLVLTM 453 V+E T P T+P P P SN+ L M Sbjct: 275 VEEPETFPDSTEPEEEPEPVSSTSNIDLLM 304 >SB_4005| Best HMM Match : CAP_GLY (HMM E-Value=5.8e-17) Length = 560 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -2 Query: 611 SASVGGPRRSTQSGGSAAMNSFPVDEAATVPVETDPPRRPSPAGDVSN 468 S + P +T++GG N+ V +A +P++T PP +P SN Sbjct: 8 SVAAETPASNTRNGGKPLNNNGNVADA--MPIDTAPPAKPEVEPKASN 53 >SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) Length = 497 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 355 KFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGI 456 +++ K+ R DLF +DKD + + E I+G+ Sbjct: 427 EYLIEKRLRAVDLFNCLDKDKSRSVSPEELIEGL 460 >SB_15862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 373 KSRLTDLFRKMDKDNNGLIPRNEFIDGI-VNTKFDTSPAGDGR 498 K RL +LF K+D D + I E ++ I VN K T + + R Sbjct: 78 KQRLRELFPKIDVDQDQKISLKELVEWIDVNMKKHTRKSSESR 120 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 379 RLTDLFRKMDKDNNGLIPRNEFIDGI 456 R+ +LF+++DK+ +G I NE +G+ Sbjct: 16 RVEELFKELDKNQDGKIDVNELAEGL 41 >SB_23274| Best HMM Match : DUF624 (HMM E-Value=9.3) Length = 182 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +1 Query: 352 LKFMNHKKSRLTDLFRKMDKDNNGLIPRNEFIDGIVNTKFDTSPAG 489 LKF + ++ D F K DK + +IPRN I DT P G Sbjct: 136 LKFCKYLRAGNEDSFEKADKIPDEVIPRNIIIGHQKVPLKDTPPKG 181 >SB_16160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 373 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 189 LCTFASLRRESGSVVGQVPIW 127 LCTF LRR +V+G V W Sbjct: 54 LCTFRLLRRTPSTVIGAVAYW 74 >SB_27251| Best HMM Match : Extensin_2 (HMM E-Value=0.077) Length = 1043 Score = 27.5 bits (58), Expect = 9.7 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +1 Query: 64 SVSPDYYGSRRFSRISPGRE----TPDRN-LPHYGPRFPPKGSKGAEPEFRSPRV 213 S SP+ GS + SPGR +PDR LPH P P + G RSP V Sbjct: 659 SYSPERSGSHSEPQ-SPGRGHQSGSPDRRQLPHSAPVTPQRHPHGENMIHRSPLV 712 >SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) Length = 776 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 373 KSRLTDLFRKMDKDNNGLIPRNEFIDG 453 + R +FR+MDK+ +G + EFI+G Sbjct: 146 EKRTEKIFRQMDKNLDGKLSLEEFIEG 172 >SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) Length = 198 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 379 RLTDLFRKMDKDNNGLIPRNEFIDGI 456 RL +F+++D+DN+G I NE + + Sbjct: 69 RLEKIFQEIDEDNSGYIDHNEISNAL 94 >SB_4764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 124 TPDRNLPHYGPRFPPKGSKGAEPEFRSP 207 TPDR++P P P GS P SP Sbjct: 40 TPDRSVPPTPPAVSPPGSGYVSPTLHSP 67 >SB_37295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 620 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 93 KIQSYQPWTGDARSEPAPLRTPIPAEGKQRC 185 K ++ Q T S PAP TP P GK C Sbjct: 264 KFENIQDVTQPPPSTPAPPNTPAPPSGKFSC 294 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 297 EMGEALVQPPLALPGEQPHVAPP 229 ++ E L++ PL LP E+P + PP Sbjct: 1693 DVKEDLIKQPLVLPNEKPPLPPP 1715 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,280,380 Number of Sequences: 59808 Number of extensions: 456361 Number of successful extensions: 1970 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1964 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -