BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0107 (581 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0429 + 9306862-9306970,9307834-9307942,9308538-9308616,930... 28 6.2 >09_02_0429 + 9306862-9306970,9307834-9307942,9308538-9308616, 9308806-9308922,9309185-9309314,9311071-9311111 Length = 194 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 414 VLSIFIFIYLLNLLWISTNNSRPISKIGPAVL 509 VL+I +Y LNLL+I N+ P++ AVL Sbjct: 123 VLNINTIVYGLNLLFIQPNDEDPLNHDAAAVL 154 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,911,915 Number of Sequences: 37544 Number of extensions: 202911 Number of successful extensions: 373 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -