BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0105 (615 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crum... 27 8.1 AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical ... 27 8.1 >U42839-7|AAC69012.1| 1722|Caenorhabditis elegans Drosophila crumbs homolog protein 1 protein. Length = 1722 Score = 27.5 bits (58), Expect = 8.1 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = -2 Query: 164 CD*CFLCSRPSD-RSGPGCVSTDRNVRSKC-----RCSNVSCSS 51 C+ C S D SGP C+ D KC +CS VSC S Sbjct: 472 CEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPS 515 >AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical protein T23B12.6 protein. Length = 670 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 172 PRNVINVF-YAAGPQTGVVLDVSPRTAMCVRNVDVQMCPA 56 PR++IN+ Y+ GP +LDV +C + CP+ Sbjct: 627 PRSLINLSNYSGGPTPQELLDVIDDNDICCSTPSLSRCPS 666 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,442,864 Number of Sequences: 27780 Number of extensions: 226946 Number of successful extensions: 474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -