BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0102 (406 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding pr... 26 0.60 AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding pr... 26 0.60 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 2.4 EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein. 23 3.2 EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein. 23 3.2 EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. 22 7.4 EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. 22 7.4 EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. 22 7.4 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 22 9.8 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 9.8 >AY146730-1|AAO12090.1| 131|Anopheles gambiae odorant-binding protein AgamOBP22 protein. Length = 131 Score = 25.8 bits (54), Expect = 0.60 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 400 HYRANWVPGPPSSFFFNTCY-TEYLLY--KYFCDLCVGYECL 284 HYRAN P P + F C E LY KY DL +E L Sbjct: 34 HYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENL 75 >AJ618929-1|CAF02008.1| 144|Anopheles gambiae odorant-binding protein OBPjj83b protein. Length = 144 Score = 25.8 bits (54), Expect = 0.60 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 400 HYRANWVPGPPSSFFFNTCY-TEYLLY--KYFCDLCVGYECL 284 HYRAN P P + F C E LY KY DL +E L Sbjct: 47 HYRANEFPDDPVTHCFVRCIGLELNLYDDKYGVDLQANWENL 88 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.8 bits (49), Expect = 2.4 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 366 RVFFSTLAILNTYYISIFVTYASVMNAYVKLSSR 265 RV++S + Y + I + + + Y+KL R Sbjct: 210 RVYYSAFTLCVQYVLPILIVSMAYLRIYLKLKHR 243 >EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein. Length = 160 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 35 PISRTSDWFGAVAYCHSVG 53 >EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein. Length = 162 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 37 PISRTSDWFGAVAYCHSVG 55 >EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 22 PISRTSDWFGAVAYCHSVG 40 >EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 22 PISRTSDWFGAVAYCHSVG 40 >EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein. Length = 157 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 32 PISRTSDWFGAVAYCHSVG 50 >EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein. Length = 157 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 32 PISRTSDWFGAVAYCHSVG 50 >EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein. Length = 163 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 38 PISRTSDWFGAVAYCHSVG 56 >EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein. Length = 164 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 39 PISRTSDWFGAVAYCHSVG 57 >EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein. Length = 163 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 38 PISRTSDWFGAVAYCHSVG 56 >EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 26 PISRTSDWFGAVAYCHSVG 44 >EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 26 PISRTSDWFGAVAYCHSVG 44 >EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 26 PISRTSDWFGAVAYCHSVG 44 >EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein. Length = 154 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 29 PISRTSDWFGAVAYCHSVG 47 >EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 40 PISRTSDWFGAVAYCHSVG 58 >EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein. Length = 162 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 37 PISRTSDWFGAVAYCHSVG 55 >EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 49 PISRTSDWFGAVAYCHSVG 67 >EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 49 PISRTSDWFGAVAYCHSVG 67 >EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 49 PISRTSDWFGAVAYCHSVG 67 >EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein. Length = 164 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 39 PISRTSDWFGAVAYCHSVG 57 >EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 23.4 bits (48), Expect = 3.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 214 PVSRHDNRFGNIG*CHATG 158 P+SR + FG + CH+ G Sbjct: 22 PISRTSDWFGAVAYCHSVG 40 >EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 44 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 74 >EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.2 bits (45), Expect = 7.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 285 KHS*PTHKSQKYLYSKYSV*QVLKKKLEGGP 377 +H HK+ YL K S+ Q + E GP Sbjct: 43 RHLNLVHKTVPYLKQKQSIPQTINIDDEAGP 73 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 21.8 bits (44), Expect = 9.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 343 YTEYLLYKYFCDLCV 299 Y YL++ YFC + V Sbjct: 53 YRFYLIFSYFCAMVV 67 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 21.8 bits (44), Expect = 9.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 242 VWTEETQRGPCLSA*QQIRKH 180 VW E T+ C Q+++KH Sbjct: 814 VWHEATKNQECRRMLQRVQKH 834 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,980 Number of Sequences: 2352 Number of extensions: 10126 Number of successful extensions: 69 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -