BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0098 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.19c |||zf-HIT protein Hit1 |Schizosaccharomyces pombe|c... 27 1.8 SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-gluca... 27 2.3 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 26 5.4 SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosac... 25 7.2 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 25 7.2 SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy... 25 7.2 SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc... 25 9.5 >SPAC4F10.19c |||zf-HIT protein Hit1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 154 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 407 LPPWVVRSLPINAINNNNKKTRGGARYPIRP 499 LP W + +N+NN T G + P+ P Sbjct: 26 LPCWKIHQSQCETVNDNNTTTFKGVKEPLNP 56 >SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-glucan synthase Ags1|Schizosaccharomyces pombe|chr 3|||Manual Length = 2410 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 389 DVYGPRLPPWVVRSLPINAINNNN 460 D P LPP+V S P NA NNNN Sbjct: 1809 DSVSPPLPPFVAGSNP-NARNNNN 1831 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 86 ITNTIPIS*SNVCWPRPRTVSILGDNYQD 172 +T I +S S++ PRP+ S+L +NY + Sbjct: 393 LTADIDLSKSSLATPRPKLSSLLYENYSN 421 >SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 529 RRFTTS*LGKPLALPQLNPPCRTSPLSPAGRN 624 +R T G P + P NP R SP+ A R+ Sbjct: 334 KRNLTVRAGTPQSSPNFNPAMRRSPVGAASRS 365 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 191 KINTELHFNFTGGRTSCDSAREGTTTLPI 277 K + + FNF G T C EG TT+ I Sbjct: 773 KDDNQQEFNFDTGITHCSMNDEGYTTISI 801 >SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 735 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 306 RNAYYCFTAEIGRVVVPSRAESQDVLPPVKLKCSSVLIF 190 +NA++ EI + +PS + +D+L K L F Sbjct: 55 KNAHFITLTEIQKQCIPSALKGRDILGAAKTGSGKTLAF 93 >SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1310 Score = 25.0 bits (52), Expect = 9.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 12 TTQNGMVTYWSNRDTCCFNCRTRFKLR 92 T NG+++Y+ N+D CR L+ Sbjct: 277 TLNNGVLSYYKNQDDASSACRGSINLK 303 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,800,802 Number of Sequences: 5004 Number of extensions: 56602 Number of successful extensions: 113 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -