BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0098 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 8e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 2e-05 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 43 2e-04 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 43 2e-04 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 41 8e-04 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.001 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 40 0.001 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 40 0.001 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 40 0.002 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 39 0.003 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 39 0.003 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 39 0.004 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 39 0.004 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 38 0.005 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 38 0.005 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 38 0.005 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 38 0.005 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 38 0.007 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 38 0.007 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 38 0.007 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 38 0.007 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 38 0.007 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 38 0.007 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 38 0.007 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 38 0.007 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 38 0.007 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 38 0.007 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 38 0.007 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 38 0.007 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 38 0.007 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 38 0.007 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 38 0.007 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 38 0.007 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 38 0.007 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 38 0.007 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 38 0.007 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 38 0.007 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 38 0.007 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 38 0.007 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 38 0.007 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 38 0.007 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 38 0.007 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 38 0.007 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 38 0.007 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 38 0.007 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 38 0.007 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 38 0.007 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 38 0.007 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 38 0.007 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 38 0.007 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 38 0.007 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 38 0.007 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.007 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 38 0.007 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 38 0.007 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 38 0.007 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 38 0.007 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 38 0.007 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 38 0.009 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 38 0.009 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 38 0.009 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 38 0.009 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 38 0.009 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.012 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 37 0.012 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 37 0.012 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 37 0.012 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 37 0.012 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 37 0.012 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 37 0.012 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 37 0.012 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 37 0.012 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 37 0.012 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 37 0.012 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.012 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 37 0.012 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 37 0.012 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 37 0.012 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 37 0.012 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.012 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 37 0.012 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 37 0.012 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 37 0.012 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 37 0.012 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 37 0.012 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 37 0.012 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 37 0.012 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 37 0.012 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 37 0.012 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 37 0.012 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.012 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 37 0.012 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 37 0.012 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 37 0.012 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 37 0.012 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 37 0.012 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 57.6 bits (133), Expect = 8e-09 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = +2 Query: 491 IRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 IRPIVSRITIHWP +RRDWENP L LA HPPF Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENP-GVNQLNRLAAHPPF 55 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 54.4 bits (125), Expect = 8e-08 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = +2 Query: 503 VSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +SRITIHWP VLQRRDWENP L LA HPPF Sbjct: 277 LSRITIHWPSVLQRRDWENP-GVTQLNRLAAHPPF 310 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -3 Query: 650 GRSVRP-FWLLRPAGERGDVLQGGLSWGNARGFPSHDVVKRR 528 GR++ + + PAGE+GDVLQG L G +GFPSHDVVKRR Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRR 89 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 526 PVNCNTTHYRANW 488 PVNCNTTHYRANW Sbjct: 90 PVNCNTTHYRANW 102 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/47 (55%), Positives = 27/47 (57%) Frame = +2 Query: 467 TRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 T GGA PIRPIVSRITIHWP + Y L LA HPPF Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKT-LAYTQLNRLAAHPPF 77 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 553 GKPLALPQLNPPCRTSPLSPAGRNNQKGRTDRP 651 GK LA QLN P + + RN+Q+ R DRP Sbjct: 60 GKTLAYTQLNRLAAHPPFA-SWRNSQEARADRP 91 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 618 ASWRKGGCPARGIKLG*RQGFSQSRRCKTT 529 ASWRKGGC AR + GFSQSRRCKTT Sbjct: 78 ASWRKGGCAARRLSWV-TPGFSQSRRCKTT 106 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 652 RADRCGPFGYYGQLAKGGMSCK 587 + DRCGP YY KGG + + Sbjct: 67 QGDRCGPLRYYASWRKGGCAAR 88 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 43.2 bits (97), Expect = 2e-04 Identities = 30/81 (37%), Positives = 37/81 (45%) Frame = +2 Query: 365 VGGGTCVVDVYGPRLPPWVVRSLPINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQR 544 + GGTC P+ V + P NA +K G P+ ++ VVLQR Sbjct: 33 LNGGTCTEKCDHPKTK--FVCNCPANAPGKQCEKFWGD---PLESTCRHASLALAVVLQR 87 Query: 545 RDWENPWRYPNLIPLAGHPPF 607 RDWENP L LA HPPF Sbjct: 88 RDWENP-GVTQLNRLAAHPPF 107 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/57 (43%), Positives = 31/57 (54%) Frame = -2 Query: 606 KGGCPARGIKLG*RQGFSQSRRCKTTGQ*IVIRLTIGRIGYRAPPRVFLLLLFIAFI 436 KGGC AR + GFSQSRRCKTT + L + G P R LLL+ + F+ Sbjct: 120 KGGCAARRLSWV-TPGFSQSRRCKTTASAKLACLQVDSRGSPGPKRNLLLLIRVRFL 175 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = +2 Query: 470 RGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 RGG P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 87 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/62 (40%), Positives = 32/62 (51%) Frame = +2 Query: 422 VRSLPINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHP 601 VRS P++ + +TR P+ ++ VVLQRRDWENP L LA HP Sbjct: 42 VRSCPMD---KHRVETREACGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHP 97 Query: 602 PF 607 PF Sbjct: 98 PF 99 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 41.1 bits (92), Expect = 8e-04 Identities = 21/46 (45%), Positives = 25/46 (54%) Frame = +2 Query: 470 RGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +GG P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 95 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +2 Query: 428 SLPINAINNN-NKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPP 604 SLP +N+ + TRG P+ ++ VVLQRRDWENP L LA HPP Sbjct: 66 SLPNTTRHNSLHNSTRGD---PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPP 121 Query: 605 F 607 F Sbjct: 122 F 122 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/55 (40%), Positives = 25/55 (45%) Frame = -1 Query: 652 RADRCGPFGYYGQLAKGGMSCKGDXXXXXXXXXXXXTL*NDGPVNCNTTHYRANW 488 + DRCG F + GM CK + PVNCNTTHYRANW Sbjct: 7 KGDRCGLFAIT-PAGERGMCCKAIKLGNAKGFPSHDVV-KRRPVNCNTTHYRANW 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 650 GRSVRP-FWLLRPAGERGDVLQGGLSWGNARGFPSHDVVKRR 528 GRS+ + + PAGERG + + GNARGFPSHD KRR Sbjct: 45 GRSIGAGLFAITPAGERGMCCKA-IKLGNARGFPSHDGEKRR 85 Score = 33.1 bits (72), Expect = 0.20 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 526 PVNCNTTHYRAN 491 PVNCNTTHYRAN Sbjct: 86 PVNCNTTHYRAN 97 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/53 (41%), Positives = 26/53 (49%) Frame = +2 Query: 449 NNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N K+ A P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 75 NCQTSKSNARAGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 126 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/60 (41%), Positives = 29/60 (48%) Frame = +2 Query: 428 SLPINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 S P N NN + G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 54 SSPYNTTINNTLQHYHGD--PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 110 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/45 (46%), Positives = 24/45 (53%) Frame = +2 Query: 473 GGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 G +YP ++ VVLQRRDWENP L LA HPPF Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 60 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/53 (41%), Positives = 26/53 (49%) Frame = +2 Query: 449 NNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 NN K + P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 37 NNTYKLSIADCGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 88 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +1 Query: 553 GKPLALPQLNPPCRTSPLSPAGRNNQKGRTDRP 651 GK LALP L + PLSPAGRN+++ RTDRP Sbjct: 15 GKTLALPNLIA-LQHIPLSPAGRNSEEARTDRP 46 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/48 (43%), Positives = 25/48 (52%) Frame = +2 Query: 464 KTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 K +G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 16 KAKGTKGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 62 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/45 (46%), Positives = 24/45 (53%) Frame = +2 Query: 473 GGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 G A P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 81 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +2 Query: 449 NNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +N ++ A P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 64 DNKGRRFPNKAGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 115 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = +2 Query: 455 NNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N + GG P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 42 NQARVNGGD--PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 89 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = +2 Query: 461 KKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 K+ G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 1169 KRRSQGKGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 1216 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/73 (38%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +2 Query: 398 GPRLPPWVVRSLPINAINNNNKKTRGGARY---PIRPIVSRITIHWPVVLQRRDWENPWR 568 GP L P + PI N N T + P+ ++ VVLQRRDWENP Sbjct: 29 GPHLCP---SNCPIQQSYNTNDNTHPLSTDIGDPLESTCRHASLALAVVLQRRDWENP-G 84 Query: 569 YPNLIPLAGHPPF 607 L LA HPPF Sbjct: 85 VTQLNRLAAHPPF 97 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/50 (42%), Positives = 25/50 (50%) Frame = +2 Query: 458 NKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N + G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 72 NPRINGEDGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 120 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/51 (43%), Positives = 28/51 (54%) Frame = +2 Query: 455 NNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N++K+R P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 14 NDRKSRHRGD-PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 62 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/48 (50%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +2 Query: 476 GARYPIRPIVSRITIHW----PVVLQRRDWENPWRYPNLIPLAGHPPF 607 G YP P SR + + VVLQRRDWENP L LA HPPF Sbjct: 42 GLNYPFVPKSSRHSESYYNSLAVVLQRRDWENP-GVTQLNRLAAHPPF 88 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/47 (44%), Positives = 24/47 (51%) Frame = +2 Query: 467 TRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 TR P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 65 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 449 NNNNKKTRGGARY--PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N N+ T A P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 17 NTNSSTTASSAVIGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 70 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/46 (45%), Positives = 24/46 (52%) Frame = +2 Query: 470 RGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 RG P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 45 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/48 (43%), Positives = 25/48 (52%) Frame = +2 Query: 464 KTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 K R + P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 126 KVREESGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 172 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/46 (47%), Positives = 25/46 (54%) Frame = +2 Query: 470 RGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 RGG P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 126 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +2 Query: 458 NKKTRGG---ARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +++ +GG A P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 SRREKGGQVSAGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 58 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +2 Query: 482 RYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 R P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 134 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/58 (39%), Positives = 28/58 (48%) Frame = +2 Query: 434 PINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P I ++ K G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 1034 PCKLITSDVKPLPSGGD-PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 1089 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +2 Query: 506 SRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 SRITIHWP WENP L LA HPPF Sbjct: 2 SRITIHWPSFYNVVHWENP-GVTQLNRLAAHPPF 34 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/35 (60%), Positives = 22/35 (62%) Frame = +2 Query: 503 VSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +SRIT VVLQRRDWEN L LA HPPF Sbjct: 88 LSRITNSLAVVLQRRDWENT-GVTQLNRLAAHPPF 121 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +2 Query: 482 RYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 R P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 97 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +2 Query: 482 RYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 R P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 47 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -1 Query: 616 QLAKGGMSCKGDXXXXXXXXXXXXTL*NDGPVNCNTTHYRANW 488 QLAKGG C + PVNCNTTHYRANW Sbjct: 40 QLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +2 Query: 482 RYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 R P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 50 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -3 Query: 650 GRSVRP-FWLLRPAGERGDVLQGGLSWGNARGFPSHDVVKRR 528 GR++ + + PAGERG + + GNA FPSHDVVKRR Sbjct: 14 GRAIGAGLFAITPAGERGMCCKA-IKLGNASVFPSHDVVKRR 54 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 526 PVNCNTTHYRANW 488 PVNCNTTHYRANW Sbjct: 55 PVNCNTTHYRANW 67 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 38.7 bits (86), Expect = 0.004 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +2 Query: 422 VRSLPINAINN-NNKKTRGGARYPIRPIVSR-ITIHWPVVLQRRDWENPWRYPNLIPLAG 595 V +P N + N + A + R R ++ VVLQRRDWENP L LA Sbjct: 401 VLEMPFNGVKGANGGRPHVTATFHARESTCRHASLALAVVLQRRDWENP-GVTQLNRLAA 459 Query: 596 HPPF 607 HPPF Sbjct: 460 HPPF 463 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 458 NKKTRGG--ARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +++ +GG + P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 SRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 57 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 458 NKKTRGG--ARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +++ +GG + P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 SRREKGGQVSGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 57 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/48 (43%), Positives = 25/48 (52%) Frame = +2 Query: 464 KTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 +TR P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 114 RTRFVVGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 160 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/48 (41%), Positives = 25/48 (52%) Frame = +2 Query: 464 KTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 ++ G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 40 RSLNGEGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 86 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/63 (36%), Positives = 29/63 (46%) Frame = +2 Query: 419 VVRSLPINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGH 598 V R + N + + A P+ ++ VVLQRRDWENP L LA H Sbjct: 141 VARHVNTNGADTRCQHEVAVAGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAH 199 Query: 599 PPF 607 PPF Sbjct: 200 PPF 202 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPFRQLAVITKR 634 P+ ++ VVLQRRDWENP L LA HPPF + R Sbjct: 289 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPFASWRSLVSR 336 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/44 (45%), Positives = 23/44 (52%) Frame = +2 Query: 476 GARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 130 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/59 (38%), Positives = 27/59 (45%) Frame = +2 Query: 431 LPINAINNNNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 LP A + K P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 15 LPTKAAIIQHTKKAAFQGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 72 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/44 (45%), Positives = 23/44 (52%) Frame = +2 Query: 476 GARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 745 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/40 (50%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = +2 Query: 497 PIVSRITIHW---PVVLQRRDWENPWRYPNLIPLAGHPPF 607 P++ R+ ++ VVLQRRDWENP L LA HPPF Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENP-GVTQLNRLAAHPPF 88 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -3 Query: 623 LRPAGERGDVLQGGLSWGNARGFPSHDVVKRR 528 + PAGERG + + GNA FPSHDVVKRR Sbjct: 10 ITPAGERGMCCKA-IKLGNASVFPSHDVVKRR 40 Score = 37.5 bits (83), Expect = 0.009 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 526 PVNCNTTHYRANW 488 PVNCNTTHYRANW Sbjct: 41 PVNCNTTHYRANW 53 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/51 (43%), Positives = 25/51 (49%) Frame = +2 Query: 455 NNKKTRGGARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 N KK P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 18 NTKKLPYRNGDPLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 67 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 50 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 88 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 13 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 51 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 54 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 17 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 55 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 44 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 821 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 102 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 63 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 114 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 63 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 120 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 158 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 48 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 141 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 179 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 47 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/44 (45%), Positives = 23/44 (52%) Frame = +2 Query: 476 GARYPIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 G P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 31 GVGDPLESSCRHASLALDVVLQRRDWENP-GVTQLNRLAAHPPF 73 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 48 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 86 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 21 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 59 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 36 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 74 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 28 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 63 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 101 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 48 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 83 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 99 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 54 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 47 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 85 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 114 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 113 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 151 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 65 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 103 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 60 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 24 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 62 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 49 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 87 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 72 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 110 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 28 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 66 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 72 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 110 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 47 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 53 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 91 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 50 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 50 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 31 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 69 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 64 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 102 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 55 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 93 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 79 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 117 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 67 >SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 79 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 117 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 43 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 170 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 208 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 158 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 196 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 47 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 85 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 45 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 134 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 172 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 84 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 104 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 142 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 11 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 49 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 640 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 678 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 65 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 149 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 187 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 35 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 73 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 20 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 58 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 93 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 131 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 48 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 84 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 58 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 96 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 43 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 67 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 105 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 173 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 211 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 99 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 254 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 292 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 60 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 58 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 96 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 92 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 130 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 51 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 89 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 99 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 43 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 62 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 100 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 71 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 109 >SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = +2 Query: 530 VVLQRRDWENPWRYPNLIPLAGHPPF 607 VVLQRRDWENP L L GHPPF Sbjct: 10 VVLQRRDWENP-GVTQLNRLGGHPPF 34 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 19 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 57 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 71 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 109 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 75 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 61 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 99 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 130 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 168 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 16 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 54 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 56 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 94 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 83 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 95 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 26 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 64 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 32 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 70 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 27 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 65 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 179 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 217 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 75 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 113 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 26 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 64 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 38 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 76 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 37 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 75 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 67 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 10 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 48 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 114 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 152 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 31 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 69 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 95 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 44 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 42 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 80 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 76 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 114 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 81 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 84 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 53 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 91 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 155 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 193 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 50 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 88 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 30 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 68 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 5 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 43 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 21 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 59 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 67 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 105 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 45 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 83 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 60 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 93 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 131 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 107 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 145 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 140 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 178 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 90 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 128 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 22 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 60 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 52 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 81 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 63 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 44 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 82 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 144 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 182 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 57 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 95 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 114 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 152 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 46 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 84 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 45 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 44 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 52 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 73 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 111 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 32 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 70 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 81 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 119 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 127 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 165 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 133 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 171 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 60 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 98 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 81 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 119 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 43 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 81 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 95 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 133 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 69 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 107 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 96 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 134 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 294 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 332 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 51 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 89 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 18 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 56 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 40 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 78 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 3 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 41 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 52 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 41 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 44 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 82 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 13 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 51 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 235 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 273 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 69 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 107 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 36 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 74 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 12 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 50 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 192 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 230 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 6 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 44 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 23 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 61 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 517 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 555 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 63 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 7 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 45 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 18 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 56 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 8 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 46 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 73 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 111 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 20 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 58 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 97 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 135 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = -2 Query: 618 ASWRKGGCPARGIKLG*RQGFSQSRRCKTT 529 ASWRKG A + G GFSQSRRCKTT Sbjct: 47 ASWRKGDATASRLS-GATPGFSQSRRCKTT 75 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 9 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 47 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 25 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 63 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 29 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 67 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 186 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 224 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 48 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 86 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 4 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 42 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 14 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 52 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +2 Query: 488 PIRPIVSRITIHWPVVLQRRDWENPWRYPNLIPLAGHPPF 607 P+ ++ VVLQRRDWENP L LA HPPF Sbjct: 15 PLESTCRHASLALAVVLQRRDWENP-GVTQLNRLAAHPPF 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,581,090 Number of Sequences: 59808 Number of extensions: 494158 Number of successful extensions: 7405 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7388 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -