BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0098 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125955-11|AAK71367.1| 178|Caenorhabditis elegans Hypothetical... 28 5.0 U97405-11|AAB53004.1| 672|Caenorhabditis elegans Hypothetical p... 27 8.7 >AF125955-11|AAK71367.1| 178|Caenorhabditis elegans Hypothetical protein F46E10.11 protein. Length = 178 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +2 Query: 323 SRYSYTEP*NSYLRVGGGTCVVDVYGPRLPPWVVRSLPIN 442 S SY + S R G C V Y P LPP RS P+N Sbjct: 71 STSSYCQQIRSNWRCINGCCRVPNYEPTLPPTTTRS-PVN 109 >U97405-11|AAB53004.1| 672|Caenorhabditis elegans Hypothetical protein T09B4.1 protein. Length = 672 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 353 SYLRVGGGTCVVDVYGPRLPPWVVRSLPINAIN 451 +Y+RVG + V+G PPWV +L +N Sbjct: 222 NYVRVGVNNGMESVFGWTFPPWVTITLAAVFVN 254 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,108,529 Number of Sequences: 27780 Number of extensions: 349533 Number of successful extensions: 882 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -