BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0098 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67420.1 68414.m07674 24 kDa vacuolar protein, putative simil... 28 6.2 At3g52970.1 68416.m05839 cytochrome P450 family protein cytochro... 27 8.2 >At1g67420.1 68414.m07674 24 kDa vacuolar protein, putative similar to 24 kDa vacuolar protein VP24 [Ipomoea batatas] gi|5821406|dbj|BAA83809 Length = 873 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 204 SCILILLVVGRLVTPHGKVPP-PCLFL 281 SC+ LL + RLV G VPP P +FL Sbjct: 168 SCVASLLELARLVVDSGWVPPQPVIFL 194 >At3g52970.1 68416.m05839 cytochrome P450 family protein cytochrome P450 76A2, eggplant, PIR:S38534 Length = 516 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 557 NPWRY-PNLIPLAGHPPFRQLAVITKRAAPI 646 NPW N+ LAG PP L +++R PI Sbjct: 41 NPWPVIGNIFQLAGLPPHDSLTKLSRRHGPI 71 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,552 Number of Sequences: 28952 Number of extensions: 326224 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -