BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0092 (539 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 41 6e-04 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 40 0.001 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 40 0.001 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 40 0.001 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.001 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 40 0.002 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 40 0.002 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 39 0.003 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 39 0.003 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 39 0.003 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 38 0.004 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 38 0.004 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 38 0.007 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 37 0.009 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 37 0.009 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 37 0.009 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 37 0.009 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 37 0.012 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 37 0.012 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 37 0.012 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 36 0.021 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 36 0.028 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 35 0.049 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 35 0.049 SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) 34 0.085 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 33 0.11 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 32 0.26 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 32 0.26 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 31 0.46 SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_36028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_24690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 30 1.4 SB_9140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_2173| Best HMM Match : DUF1401 (HMM E-Value=6.3) 30 1.4 SB_50776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_31163| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7536| Best HMM Match : DUF1401 (HMM E-Value=7.9) 30 1.4 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 30 1.4 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 30 1.4 SB_27890| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_18718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 29 2.4 SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) 29 2.4 SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) 29 3.2 SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 28 4.2 SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) 28 4.2 SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 28 4.2 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) 28 4.2 SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 4.2 SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 28 4.2 SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 27 7.4 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 27 7.4 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 27 9.8 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 27 9.8 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 27 9.8 SB_40696| Best HMM Match : DUF1096 (HMM E-Value=5.5) 27 9.8 SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 27 9.8 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 PL RRD L +L+++ +G+ S L ++ PA+ Y+ H + ++ + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISLASLLSPATSRYNTRNYHSNNYRLFFTH----NQN 247 Query: 304 RFQRSFLPRTIRLWNELPS 360 ++ S+ PRT++LWN LPS Sbjct: 248 YYRNSYFPRTVKLWNSLPS 266 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 PL RRD L +L+++ +G+ S ++ PA+ Y+ H + Y L + Sbjct: 689 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 745 Query: 304 RFQRSFLPRTIRLWNELPS 360 ++ S+ PRT++LWN LPS Sbjct: 746 -YRNSYFPRTVKLWNSLPS 763 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 PL RRD L +L+++ +G+ S ++ PA+ Y+ H + Y L + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 248 Query: 304 RFQRSFLPRTIRLWNELPS 360 ++ S+ PRT++LWN LPS Sbjct: 249 -YRNSYFPRTVKLWNSLPS 266 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 41.1 bits (92), Expect = 6e-04 Identities = 30/99 (30%), Positives = 43/99 (43%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRRSRTNSSKY--NQIQSNVL 193 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 194 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 40.3 bits (90), Expect = 0.001 Identities = 32/95 (33%), Positives = 45/95 (47%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 +PL RR SL +L + L +++ SR RT +H +Y P + T Sbjct: 144 QPLEDRRRTSSLVLLNSGLNNASILPLEDLMKPSRALPRT-QHSE----FYTIP-NARTD 197 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 ++ SFLPR +RLWN LP +V R F GL Sbjct: 198 IYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 40.3 bits (90), Expect = 0.001 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 183 LELRRTMARLTLLYKLSRGQIDIDTSTYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 237 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 238 FYSFFPRTIRHWNTLPNELV-ELDSIEHFKRDL 269 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 39.9 bits (89), Expect = 0.001 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 79 LELRRTMARLTLLYKLSRGQIDIDTSMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 133 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 134 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 165 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 39.9 bits (89), Expect = 0.001 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 266 LELRRTMARLTLLYKLSRGQIDIDTSMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 320 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 321 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 352 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 39.9 bits (89), Expect = 0.001 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 571 LELRRTMARLTLLYKLSRGQIDIDTSMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 625 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 626 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 657 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 39.5 bits (88), Expect = 0.002 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 280 LELRRTMARLTLLYKLSRGQIDIDTNMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 334 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 335 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 366 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 39.5 bits (88), Expect = 0.002 Identities = 31/95 (32%), Positives = 42/95 (44%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 +PL RR SL +L + L ++ SR RT H + L + T Sbjct: 143 QPLEDRRRTSSLVLLNSGLNNASILPLEDLRKPSRALPRTQ------HSEFYTILNARTD 196 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 ++ SFLPR +RLWN LP +V R F GL Sbjct: 197 IYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +1 Query: 247 RHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRV 417 R R HP PL +S+ SF RTI WN LP+ +F E + FK + R+ Sbjct: 823 RKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNLPALLFNEPCSLPIFKDKISRL 879 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 39.5 bits (88), Expect = 0.002 Identities = 28/93 (30%), Positives = 44/93 (47%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 486 LELRRTMARLTLLYKLSRGQIDIDTNMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 540 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 541 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 572 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 38.7 bits (86), Expect = 0.003 Identities = 29/99 (29%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 816 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 868 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 869 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 906 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLS 423 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L +S Sbjct: 1627 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSALAPAIS 1681 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 38.7 bits (86), Expect = 0.003 Identities = 29/99 (29%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 96 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 148 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 149 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 186 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 38.7 bits (86), Expect = 0.003 Identities = 29/99 (29%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 735 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 787 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 788 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 825 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 38.3 bits (85), Expect = 0.004 Identities = 29/99 (29%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 193 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 194 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1073 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1122 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 38.3 bits (85), Expect = 0.004 Identities = 29/99 (29%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 50 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 102 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LPS V E + FK VL Sbjct: 103 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 140 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 37.9 bits (84), Expect = 0.005 Identities = 27/92 (29%), Positives = 40/92 (43%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 507 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 559 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 399 SF PRTIR WN LPS V E + FK Sbjct: 560 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 590 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 37.5 bits (83), Expect = 0.007 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 403 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 455 Query: 304 RFQRSFLPRTIRLWNELPSTV 366 SF PRTIR WN LPS V Sbjct: 456 SHSYSFFPRTIRTWNLLPSEV 476 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 37.1 bits (82), Expect = 0.009 Identities = 28/99 (28%), Positives = 42/99 (42%) Frame = +1 Query: 124 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTV 303 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 182 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 234 Query: 304 RFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 420 SF PRTIR WN LP+ V E + FK VL Sbjct: 235 SHSYSFFPRTIRTWNLLPAQVV-ESSSIDSFKSSALPVL 272 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 37.1 bits (82), Expect = 0.009 Identities = 23/77 (29%), Positives = 37/77 (48%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + + H + YY E +++ ++ Sbjct: 512 LELRRTMARLTLLYKLSRGQIDIDTSMYLRPHQDLRTRNSHNFK---YYQE--KATKNKY 566 Query: 310 QRSFLPRTIRLWNELPS 360 SF PRTIR WN LP+ Sbjct: 567 FYSFFPRTIRHWNTLPN 583 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 37.1 bits (82), Expect = 0.009 Identities = 28/93 (30%), Positives = 45/93 (48%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L LRR L +LY++ G+ + + H+ R R+ H + +++ ++ Sbjct: 729 LELRRTMARLTLLYKLSRGQIDIDTNMYLRP----HQDLRTRNS-HNFKCYQEKATKNKY 783 Query: 310 QRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 408 SF PRTIR WN LP+ + E + FKR L Sbjct: 784 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 815 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 37.1 bits (82), Expect = 0.009 Identities = 25/76 (32%), Positives = 38/76 (50%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F S Sbjct: 112 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKELYYNQ-LQANTLAFNYS 165 Query: 319 FLPRTIRLWNELPSTV 366 F R IR+WN LP+ V Sbjct: 166 FFARAIRIWNLLPNDV 181 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 37.1 bits (82), Expect = 0.009 Identities = 25/76 (32%), Positives = 38/76 (50%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F S Sbjct: 472 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKELYYNQ-LQANTLAFNYS 525 Query: 319 FLPRTIRLWNELPSTV 366 F R IR+WN LP+ V Sbjct: 526 FFARAIRIWNLLPNDV 541 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 122 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 158 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 441 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 477 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 1427 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 387 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 423 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 35.9 bits (79), Expect = 0.021 Identities = 20/56 (35%), Positives = 26/56 (46%) Frame = +1 Query: 214 IPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERY 381 +P S R HP + + + T F+ SF+PR IRLWN L TV Y Sbjct: 713 LPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTVVLAAY 768 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 35.5 bits (78), Expect = 0.028 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 238 RTGRHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 294 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 335 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 35.5 bits (78), Expect = 0.028 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 256 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 +R H + L S+ + F SF PR IR WN LP + Sbjct: 262 TRRHSLSFQQLHSNILSFNYSFFPRAIRAWNLLPDNI 298 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 35.5 bits (78), Expect = 0.028 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 238 RTGRHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 366 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 245 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 35.1 bits (77), Expect = 0.037 Identities = 30/117 (25%), Positives = 48/117 (41%) Frame = +2 Query: 149 SVPSVFYTVCSMGSALRNCSR*YQHLVFTIAPAATGVEFIHTTWSHCGHPQCVSRDLFCH 328 +VP+V +TV ++ + N + VFT+ V + + CG PQC C Sbjct: 135 TVPNVVFTVRNVVFTVPNVVFTVPNAVFTVPNVVFTVPNVVFS-PQCGSPQCGIHSTQCG 193 Query: 329 VPSGYGMSSPPRCFPSAMTCPSSNEACGEY*AVGSGLALPLALLKSMGDGNHSPSGG 499 + S P+C + C + CG + + G+ P + S G HSP G Sbjct: 194 IHSPQCGIHSPQCGIYSPQCGIHSPQCGIH-STQCGIHSPQCGIHSPQCGIHSPQCG 249 Score = 30.3 bits (65), Expect = 1.1 Identities = 25/87 (28%), Positives = 38/87 (43%) Frame = +2 Query: 152 VPSVFYTVCSMGSALRNCSR*YQHLVFTIAPAATGVEFIHTTWSHCGHPQCVSRDLFCHV 331 VP+V +TV ++ S + N ++VF+ P IH+T CG PQC C + Sbjct: 393 VPNVVFTVPNVVSTVPNVVSTVPNVVFS--PQCG----IHST--QCGSPQCGIHSTQCGI 444 Query: 332 PSGYGMSSPPRCFPSAMTCPSSNEACG 412 S P+C + C + CG Sbjct: 445 HSTQCGIHSPQCGIHSPQCGIHSTQCG 471 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 34.7 bits (76), Expect = 0.049 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 PL RR L + Y+ + + + E+ + I RT + RS HP L +T Sbjct: 205 PLSKRRQNARLTLFYKAVNKKSALEIPDNID-----RRTRQLRSS-HPDKFIELCPTTEA 258 Query: 307 FQRSFLPRTIRLWNELP 357 ++ SF RTI+ WN+LP Sbjct: 259 YKNSFFCRTIKEWNKLP 275 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 34.7 bits (76), Expect = 0.049 Identities = 24/76 (31%), Positives = 36/76 (47%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 +R S IL+ FH ++ +P R+ R R Y L+++T+ F S Sbjct: 1182 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKE-LYCNQLQANTLTFNYS 1235 Query: 319 FLPRTIRLWNELPSTV 366 F R IR+WN LP+ V Sbjct: 1236 FFARAIRIWNLLPNDV 1251 >SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) Length = 251 Score = 33.9 bits (74), Expect = 0.085 Identities = 23/76 (30%), Positives = 34/76 (44%) Frame = +1 Query: 130 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRF 309 L +RR L + Y++ HG + +P R + +S Y P S+ Sbjct: 160 LEIRRKRARLLMFYKIHHGLVVTDGLPAVPPMYIISRHMKSQS-----YKVPPSSTDYHK 214 Query: 310 QRSFLPRTIRLWNELP 357 ++SF P TIR WN LP Sbjct: 215 KKSFFPPTIRDWNCLP 230 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 33.5 bits (73), Expect = 0.11 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 RR+ L YR+ G SE + Y T ++ HP + T F+ S Sbjct: 161 RREKARLAFFYRINKG-LSEISMPPYATPQMYTITRQY----HPQRFALVSCKTNVFKES 215 Query: 319 FLPRTIRLWNELP-STV 366 F P IR+WN LP ST+ Sbjct: 216 FFPHAIRMWNGLPVSTI 232 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 33.5 bits (73), Expect = 0.11 Identities = 25/77 (32%), Positives = 37/77 (48%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 PL RR L + Y+ + + + ++ + I RT + RS HP L T Sbjct: 314 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSS-HPDKFIELCPRTEA 367 Query: 307 FQRSFLPRTIRLWNELP 357 F+ SF RTI+ WN+LP Sbjct: 368 FKNSFFCRTIKEWNKLP 384 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.1 bits (72), Expect = 0.15 Identities = 21/78 (26%), Positives = 32/78 (41%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 RR L + Y++ G + + + T + + L P + + F S Sbjct: 772 RRIVSDLALFYKINSGLVKIDFLPDVSPKPAVYFTRTSACNSYQFSLLPAKINAFLF--S 829 Query: 319 FLPRTIRLWNELPSTVFP 372 F RTI +WN LP VFP Sbjct: 830 FYSRTIPVWNALPQAVFP 847 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 32.7 bits (71), Expect = 0.20 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 RR+ L YR+ G SE + Y T ++ HP + T F+ S Sbjct: 579 RREKARLAFFYRINKG-LSEISTPPYATPQMYTITRQY----HPQRFALVSCKTNVFKES 633 Query: 319 FLPRTIRLWNELP-STV 366 F P IR+WN LP ST+ Sbjct: 634 FFPHAIRMWNGLPVSTI 650 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 32.3 bits (70), Expect = 0.26 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 323 CHVPSGYGMSSPPRCFPSAMTCPSSNEAC 409 C P GY + +P RC S +C SS AC Sbjct: 2147 CSCPQGYRLENPYRCVLSNASCASSEFAC 2175 Score = 30.7 bits (66), Expect = 0.80 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 287 CGHPQCVSRDLFCHVPSGYGMSSPPRCFPSAMTCPSSNEAC 409 C +C+SRD C + G SS + +TCP+ C Sbjct: 3053 CPSGRCISRDWLCDGDNDCGDSSDEKAGECHVTCPAGQARC 3093 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 32.3 bits (70), Expect = 0.26 Identities = 23/77 (29%), Positives = 39/77 (50%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 PL RR L + Y+ + + + ++ + I RT + RS + ++E L T Sbjct: 611 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSSLPDKFIE-LCPRTEA 664 Query: 307 FQRSFLPRTIRLWNELP 357 ++ SF RTI+ WN+LP Sbjct: 665 YKNSFFCRTIKEWNKLP 681 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 31.5 bits (68), Expect = 0.46 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWNELPSTV 366 L+S+ + + SF R IR+WN LPS V Sbjct: 227 LQSNILSYNYSFFARAIRIWNLLPSNV 253 >SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 0.80 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +1 Query: 148 FGSLC-ILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRSFL 324 F S+C ++Y +G + + ++ H S + +Y++ S + QR+ Sbjct: 69 FESVCHLMYDTRNGTAPPNILNLFTDTKSVHSYNTRSSTSNKFYIQ---KSRLEIQRNSF 125 Query: 325 PRT-IRLWNELPSTV 366 R R+WNELP ++ Sbjct: 126 SRVGARVWNELPQSL 140 >SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 729 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 281 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 337 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 338 GDRSFSNFAAKLWNSLP 354 >SB_43430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_42334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_36028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 80 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 136 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 137 GDRSFSNFAAKLWNSLP 153 >SB_24690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 92 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 148 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 149 GDRSFSNFAAKLWNSLP 165 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 556 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 612 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 613 GDRSFSNFAAKLWNSLP 629 >SB_9140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFEILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 441 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 497 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 498 GDRSFSNFAAKLWNSLP 514 >SB_2173| Best HMM Match : DUF1401 (HMM E-Value=6.3) Length = 275 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 184 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 240 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 241 GDRSFSNFAAKLWNSLP 257 >SB_50776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 184 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 240 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 241 GDRSFSNFAAKLWNSLP 257 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 84 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 140 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 141 GDRSFSNFAAKLWNSLP 157 >SB_31163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_7536| Best HMM Match : DUF1401 (HMM E-Value=7.9) Length = 180 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 80 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 136 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 137 GDRSFSNFAAKLWNSLP 153 >SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 630 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 530 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 586 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 587 GDRSFSNFAAKLWNSLP 603 >SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) Length = 385 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 285 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 341 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 342 GDRSFSNFAAKLWNSLP 358 >SB_27890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 65 PVASRIDFKILTITHKALHNQALEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 121 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 122 GDRSFSNFAAKLWNSLP 138 >SB_18718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 92 PVASRIDFKILTITHKALHNQALEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 148 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 149 GDRSFSNFAAKLWNSLP 165 >SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) Length = 768 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 668 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSLSLRSANKNLLVIPKSRTKTY 724 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 725 GDRSFSNFAAKLWNSLP 741 >SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 2.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFDMSFIPRTIRTWN 124 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 441 PVASRIDFKILTITHKGLHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 497 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 498 GDRSFSNIAAKLWNSLP 514 >SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/77 (25%), Positives = 32/77 (41%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ + DF L I ++ H + E + E++ Y + RS + P + Sbjct: 690 PVATKIDFKILIITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 746 Query: 307 FQRSFLPRTIRLWNELP 357 RSF +LWN LP Sbjct: 747 GDRSFSNFAAKLWNSLP 763 >SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) Length = 448 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 328 RTIRLWNELPSTVFPERYDM-SFFKRGLWRVLSGRQRLGSAPGIA 459 + +R+W E+PS V +RY+M + F+ + L G + GS P I+ Sbjct: 59 KQLRIWREVPSGVH-KRYEMNATFRTNMKAALCGGESPGSNPIIS 102 >SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) Length = 474 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 238 DGKNEMLVSSRTIPQSTPHGTYGIKYRGNRSPSANPEAP 122 DG+ ++ S+ +P+ PH + YR N S S NP +P Sbjct: 139 DGRYVIVGSASYVPED-PHPFFFDIYRNNESVSPNPRSP 176 >SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 398 LQANVNAFGMSFIPRTIRTWN 418 >SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) Length = 318 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 431 SGLALPLALLKSMGDGNHSPSGGPYARLPTK 523 SG+ PLA S D H P GGP A PT+ Sbjct: 33 SGIFSPLASSTSASDSRHRPVGGP-AYSPTE 62 >SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 467 LQANVNAFGMSFIPRTIRTWN 487 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 208 LQANVNAFGMSFIPRTIRTWN 228 >SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 837 LQANVNAFGMSFIPRTIRTWN 857 >SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 442 LQANVNAFGMSFIPRTIRTWN 462 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 28.3 bits (60), Expect = 4.2 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +1 Query: 127 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVR 306 P+ R DF L I + H + E + E++ + R V+ L +S T Sbjct: 1677 PVATRIDFKILTITHIALHNQAPEYITELLTP----YTPSRSLRSVNKNLLVIPKSRTKT 1732 Query: 307 F-QRSFLPRTIRLWNELP 357 + RSF +LWN LP Sbjct: 1733 YGDRSFSNFAAKLWNSLP 1750 >SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 286 LRSSTVRFQRSFLPRTIRLWN 348 L+++ F SF+PRTIR WN Sbjct: 55 LQANVNAFGMSFIPRTIRTWN 75 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 27.5 bits (58), Expect = 7.4 Identities = 20/73 (27%), Positives = 30/73 (41%) Frame = +1 Query: 139 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQRS 318 R DF L I ++ H + E + E++ Y + RS + P + RS Sbjct: 361 RIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTYGDRS 417 Query: 319 FLPRTIRLWNELP 357 F +LWN LP Sbjct: 418 FSNFAAKLWNSLP 430 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 316 SFLPRTIRLWNELPSTVFPE-RYDMSF 393 SF P +I+ WN LP+T R + SF Sbjct: 752 SFFPWSIKFWNNLPATALKSTRVNQSF 778 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 27.1 bits (57), Expect = 9.8 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +1 Query: 316 SFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAE 462 SF P +I WN LP ++ + + FK L + L + G G AE Sbjct: 525 SFFPWSINFWNNLPGSITNIK-EKGKFKEKLQQHLIDNGQWGEGQGDAE 572 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 27.1 bits (57), Expect = 9.8 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +1 Query: 139 RRDFGSLCILYRMFHG--ECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQ 312 RR + + +++ +G + E F ++P +R H + R H + S + Sbjct: 1033 RRTLSRMSMFHQVVYGTVDIKREPF-LVPMNR--HSRNGNSKRFHRTH-----SKCNQHA 1084 Query: 313 RSFLPRTIRLWNELPSTV 366 SF P +I+ WN LP ++ Sbjct: 1085 NSFFPWSIKFWNNLPGSI 1102 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 27.1 bits (57), Expect = 9.8 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +1 Query: 139 RRDFGSLCILYRMFHG--ECSEELFEMIPASRFYHRTGRHRSRVHPYYLEPLRSSTVRFQ 312 RR + + +++ +G + E F ++P +R H + R H + S + Sbjct: 354 RRTLSRMSMFHQVVYGTVDIKREPF-LVPMNR--HSRNGNSKRFHRTH-----SKCNQHA 405 Query: 313 RSFLPRTIRLWNELPSTV 366 SF P +I+ WN LP ++ Sbjct: 406 NSFFPWSIKFWNNLPGSI 423 >SB_40696| Best HMM Match : DUF1096 (HMM E-Value=5.5) Length = 582 Score = 27.1 bits (57), Expect = 9.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 447 PWHC*SPWATVTTHHQVGRMPV 512 PW C S W + H ++G +PV Sbjct: 224 PWKCWSQWCSSRDHIKLGDLPV 245 >SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 265 HPYYLEPLRSSTVRFQRSFLPRTI-RLW 345 HPYY E + SS + F+ + + RTI R W Sbjct: 78 HPYYSERMLSSVLLFRENGIIRTIQREW 105 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 27.1 bits (57), Expect = 9.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 122 WSLWVCGGTSVPSVFYTVCSMGSALR 199 W CG S+P + Y C+ GS R Sbjct: 996 WRGLYCGSRSIPCLDYNPCAFGSTCR 1021 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,331,514 Number of Sequences: 59808 Number of extensions: 463608 Number of successful extensions: 1638 Number of sequences better than 10.0: 101 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1635 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -