BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0091 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 28 1.4 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 5.8 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 27.9 bits (59), Expect = 1.4 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 98 DTTATDSLPTASEPTASQPTASEP-TASQPTAS 193 D+T DS P+ + QPT S P T S P+ S Sbjct: 294 DSTTIDSTPSTIATSTLQPTTSSPITTSAPSLS 326 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 104 TATDSLPTASEPTASQPTASEPTASQPTASQ 196 ++T S P + P S+P+ SQP+ SQ Sbjct: 74 SSTGSTPRTASPAVGNQDYSKPSYSQPSYSQ 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.316 0.125 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,118,830 Number of Sequences: 5004 Number of extensions: 12497 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -