BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0091 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.7 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 4.7 Identities = 19/65 (29%), Positives = 26/65 (40%), Gaps = 7/65 (10%) Frame = -2 Query: 660 GGMGLAQRLRDHSLAGGSGVRGMSEHWSAISCVSSGIT-------SVGDNGSGAIGSVGD 502 G G+ L+ G GV+GM+ + S G T V GSG + S Sbjct: 870 GVQGVPGLLQGVQQVFGQGVQGMNVPYGMQRGQSGGQTWSNSQVQGVAVPGSGIVASGQQ 929 Query: 501 HGGGY 487 H GG+ Sbjct: 930 HAGGW 934 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.125 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,968 Number of Sequences: 438 Number of extensions: 1123 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -