BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0090 (680 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024853-4|AAK68586.1| 746|Caenorhabditis elegans Hypothetical ... 29 3.1 U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AC024853-4|AAK68586.1| 746|Caenorhabditis elegans Hypothetical protein Y71F9AR.3 protein. Length = 746 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 578 IPEFPQHSSNEYSPPSSGMFSNFLAPGL 495 +P P S E SPPSS FSN AP L Sbjct: 190 LPSTP--SEREASPPSSSQFSNSAAPNL 215 >U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical protein M01H9.2 protein. Length = 439 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -1 Query: 575 PEFPQHSSNEYSPPSSGMFSNFLAPGLGPLTADSALCSVSLIG 447 P++P N +P + FL PG L S ++L+G Sbjct: 240 PQYPDEKLNTIAPNPMQLVEPFLTPGQNDLNPKSMSSLINLLG 282 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,206,864 Number of Sequences: 27780 Number of extensions: 348795 Number of successful extensions: 917 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 917 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -