BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0085 (689 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;... 174 2e-42 UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ... 123 4e-27 UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0... 103 3e-21 UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n... 65 1e-09 UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative... 64 2e-09 UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;... 54 3e-06 UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve... 51 2e-05 UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10;... 50 4e-05 UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ... 48 2e-04 UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ... 48 2e-04 UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontog... 47 5e-04 UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein;... 44 0.003 UniRef50_Q9PLI5 Cluster: Uncharacterized protein TC_0114; n=47; ... 42 0.019 UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ... 38 0.18 UniRef50_Q1NYX4 Cluster: Cell wall-associated hydrolase; n=3; Ba... 38 0.31 UniRef50_A7CI87 Cluster: Putative uncharacterized protein; n=21;... 35 2.2 UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl... 35 2.2 UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ... 34 3.8 UniRef50_Q4RJ84 Cluster: Chromosome 1 SCAF15039, whole genome sh... 33 6.6 >UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein; n=4; Eukaryota|Rep: Putative senescence-associated protein - Pisum sativum (Garden pea) Length = 282 Score = 174 bits (423), Expect = 2e-42 Identities = 85/109 (77%), Positives = 88/109 (80%) Frame = -1 Query: 329 HQ*GKTNLSHDGLNPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYP 150 HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSKSNVAMNAWLPQASYP Sbjct: 57 HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKSNVAMNAWLPQASYP 116 Query: 149 CGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIKPAFALLLHARFLSSL 3 CGNFS TS K LKDR A LS+ + VL I IK AF LL H RFL SL Sbjct: 117 CGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAFTLLFHTRFLFSL 165 Score = 38.7 bits (86), Expect = 0.13 Identities = 23/49 (46%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -2 Query: 478 ARLASA----LEAFRHNPADGSFXXXXXXXXX*TKCPKLRFLSY*AVLL 344 AR+AS+ LEAF HNP GSF T C RFLSY LL Sbjct: 4 ARIASSPDSDLEAFSHNPTHGSFAPLAFQPSAMTNCANQRFLSYYVELL 52 >UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 116 Score = 123 bits (297), Expect = 4e-27 Identities = 64/93 (68%), Positives = 72/93 (77%) Frame = +1 Query: 1 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIKSF*QEVPEKLPQG*LACGSQAF 180 LSE+ NL +KR KA LI +FS + + ES AYRSF+ SF EV EKLPQG LACGSQ F Sbjct: 24 LSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKLEVSEKLPQGQLACGSQEF 83 Query: 181 IATLLFDPSMSALPIIAKQNSPSVGLFTHQKGT 279 I+TLLFDPSMSALPII KQNS VGLFT Q+GT Sbjct: 84 ISTLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116 >UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG00134 - Rattus norvegicus (Rat) Length = 221 Score = 103 bits (248), Expect = 3e-21 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -1 Query: 266 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSC*K 117 WVNNPTLGEFCF MIGRADIEGSKS+VAMNAW PQASYPCGNFS TSC K Sbjct: 25 WVNNPTLGEFCFTMIGRADIEGSKSDVAMNAWPPQASYPCGNFSDTSCLK 74 >UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1; Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry - Xenopus tropicalis Length = 154 Score = 65.3 bits (152), Expect = 1e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -1 Query: 227 MIGRADIEGSKSNVAMNAWLPQASYPCGN 141 MIGRADIEGSKSNVAMNAWLPQASYPCG+ Sbjct: 1 MIGRADIEGSKSNVAMNAWLPQASYPCGS 29 Score = 43.2 bits (97), Expect = 0.006 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 111 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAE 1 Y GSIG AF V +RTE+ +Q SF PF E+SVL E Sbjct: 25 YPCGSIGHAFTVCIRTENQNQMSFYPFVLHEISVLVE 61 >UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative; n=1; Plasmodium vivax|Rep: Senescence-associated protein, putative - Plasmodium vivax Length = 131 Score = 64.5 bits (150), Expect = 2e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 227 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTS 126 MIGRADIEGSKS VA +AW PQASYPCGNFS TS Sbjct: 1 MIGRADIEGSKSYVARSAWQPQASYPCGNFSDTS 34 Score = 38.3 bits (85), Expect = 0.18 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = -3 Query: 105 KGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAE 1 KGSIG AF +E +Q SF PF+ +E+SVL+E Sbjct: 49 KGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLSE 83 >UniRef50_Q7RN96 Cluster: Putative senescence-associated protein; n=3; Eukaryota|Rep: Putative senescence-associated protein - Plasmodium yoelii yoelii Length = 205 Score = 54.0 bits (124), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 227 MIGRADIEGSKSNVAMNAWLPQASYPCGN 141 MIGRADIE SKS VA NAW PQASYPCG+ Sbjct: 1 MIGRADIERSKSYVAKNAWQPQASYPCGS 29 Score = 36.3 bits (80), Expect = 0.71 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = -3 Query: 111 YTKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAE 1 Y GSIG AF +E +Q SF PF+ +E+SVL E Sbjct: 25 YPCGSIGHAFTFSTFSESRNQTSFSPFSLQEISVLFE 61 >UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 746 Score = 51.2 bits (117), Expect = 2e-05 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 343 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 432 +VILLSTRGTA SD W +H AE+P+VRSYH Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689 >UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10; Firmicutes|Rep: Putative uncharacterized protein - Listeria monocytogenes FSL N3-165 Length = 112 Score = 50.4 bits (115), Expect = 4e-05 Identities = 28/57 (49%), Positives = 30/57 (52%) Frame = +3 Query: 138 KVTTGITGLWQPSVHSDVAF*SFDVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQ 308 K T GITGL P VH D DVGSS+ K W V P K + SWV VVRQ Sbjct: 45 KATPGITGLSPPRVHIDGEVWHLDVGSSHPGAVVGPKGWAVRPLKRHASWVQNVVRQ 101 >UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; Dikarya|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 160 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -1 Query: 182 MNAWLPQASYPCGNFSGTS 126 MNAWLPQASYPCGNFSGTS Sbjct: 1 MNAWLPQASYPCGNFSGTS 19 Score = 37.5 bits (83), Expect = 0.31 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -3 Query: 108 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAE 1 +KGSIG F V + TE+ +Q F PF E+SVL E Sbjct: 26 SKGSIGHTFMVCIHTENQNQGDFYPFVLLEISVLHE 61 >UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; Archaea|Rep: RRNA intron-encoded endonuclease - Thermoproteus sp. IC-062 Length = 272 Score = 48.0 bits (109), Expect = 2e-04 Identities = 31/63 (49%), Positives = 34/63 (53%) Frame = +3 Query: 135 RKVTTGITGLWQPSVHSDVAF*SFDVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQVS 314 RKVT GITG + V D A DV SS+ A AK + P KGNV WV TV RQV Sbjct: 204 RKVTPGITGSSRVRVPIDPAVWYPDVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVG 263 Query: 315 FTL 323 L Sbjct: 264 LYL 266 >UniRef50_Q14C49 Cluster: 4933429F08Rik protein; n=3; Euarchontoglires|Rep: 4933429F08Rik protein - Mus musculus (Mouse) Length = 29 Score = 46.8 bits (106), Expect = 5e-04 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 182 MNAWLPQASYPCGNFSGTSC*K 117 MNAW PQASYPCGNFS TSC K Sbjct: 1 MNAWPPQASYPCGNFSDTSCLK 22 >UniRef50_UPI0000DA4670 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 440 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -3 Query: 219 KSRHRRIKKQRRYERLAATSQ 157 KSRHRRIKK+RRYERLAATSQ Sbjct: 50 KSRHRRIKKRRRYERLAATSQ 70 >UniRef50_Q9PLI5 Cluster: Uncharacterized protein TC_0114; n=47; cellular organisms|Rep: Uncharacterized protein TC_0114 - Chlamydia muridarum Length = 122 Score = 41.5 bits (93), Expect = 0.019 Identities = 20/37 (54%), Positives = 22/37 (59%) Frame = -3 Query: 270 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATS 160 L+GEQ N W +L D SRHR K RRYE L A S Sbjct: 64 LIGEQPNPWDLLQPQDAMSRHRGAKPPRRYELLVAIS 100 >UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; Eukaryota|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 54 Score = 38.3 bits (85), Expect = 0.18 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 254 DCSPIKRERELGLDRRET 307 DCSP RERELGLDRRET Sbjct: 6 DCSPANRERELGLDRRET 23 >UniRef50_Q1NYX4 Cluster: Cell wall-associated hydrolase; n=3; Bacteria|Rep: Cell wall-associated hydrolase - Candidatus Sulcia muelleri str. Hc (Homalodisca coagulata) Length = 132 Score = 37.5 bits (83), Expect = 0.31 Identities = 19/37 (51%), Positives = 21/37 (56%) Frame = -3 Query: 270 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATS 160 LMGEQ N W +L D SRHR + RR E L TS Sbjct: 64 LMGEQPNPWDLLQPQDVTSRHRGAEPPRRCELLGETS 100 >UniRef50_A7CI87 Cluster: Putative uncharacterized protein; n=21; Bacteria|Rep: Putative uncharacterized protein - Ralstonia pickettii 12D Length = 226 Score = 34.7 bits (76), Expect = 2.2 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -3 Query: 270 LMGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATS 160 L GEQ W L D SRHR K +RRYE L S Sbjct: 64 LNGEQPYPWDRLQPQDEMSRHRGAKHRRRYELLGGIS 100 >UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 147 Score = 34.7 bits (76), Expect = 2.2 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 263 VNNPTLGEFCFAMIGRADIEGSK 195 VN+P L EFCF + RADIEGS+ Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142 >UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; Bacteria|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 76 Score = 33.9 bits (74), Expect = 3.8 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 245 QALDCSPIKRERELGLDRRET 307 Q CSPIK RELGL+RRET Sbjct: 17 QGFGCSPIKVVRELGLERRET 37 >UniRef50_Q4RJ84 Cluster: Chromosome 1 SCAF15039, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 1 SCAF15039, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 451 Score = 33.1 bits (72), Expect = 6.6 Identities = 21/77 (27%), Positives = 33/77 (42%) Frame = +3 Query: 363 ERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCD 542 E R+ A+ +A GGA SA C N + +S + + + V+ +S SK Sbjct: 301 ESQRTASAASQAIQQALGGASTSSAFPCENGGPSSSSSSSAPVSQIPVKSSDSPPSKGVS 360 Query: 543 FTSRVSHSKRETRRRSP 593 S + KR+ SP Sbjct: 361 DISHLVRKKRKPEEESP 377 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,861,216 Number of Sequences: 1657284 Number of extensions: 14015840 Number of successful extensions: 34937 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 33853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34929 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -