BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0085 (689 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 31 0.72 At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.3 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 2.9 At4g29310.1 68417.m04190 expressed protein 27 8.9 At4g27120.2 68417.m03898 expressed protein 27 8.9 At4g27120.1 68417.m03897 expressed protein 27 8.9 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 27 8.9 At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containi... 27 8.9 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 8.9 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 157 LACGSQAFIATLLFDPSMSALPIIAKQNSPSVGLFT 264 + C S + + LL P + L I+ QN P+VGLFT Sbjct: 1 MECSSVSVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +3 Query: 294 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 470 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 471 SLAESGKD 494 S GK+ Sbjct: 692 SPDSGGKE 699 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 1 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 114 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 209 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 48 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 399 LGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-QCDFTSRVSHSKRE 575 + RA GG ++ AS + +++ E+G + E+GG++ + +RE Sbjct: 47 VARAGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQARASKKKEKKRQERE 106 Query: 576 TRRRSPFGSRRS 611 +R++ +R S Sbjct: 107 AQRQAEEATRES 118 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 399 LGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK-QCDFTSRVSHSKRE 575 + RA GG ++ AS + +++ E+G + E+GG++ + +RE Sbjct: 47 VARAGGGRRMRRRPAASGASSSTSNVQENGSGSEDEDEDEAGGTQARASKKKEKKRQERE 106 Query: 576 TRRRSPFGSRRS 611 +R++ +R S Sbjct: 107 AQRQAEEATRES 118 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = -2 Query: 688 EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 536 +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At1g59720.1 68414.m06720 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 638 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = +3 Query: 351 TAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDM 497 T Y S G LVH L A PSA N + SLAE+ DM Sbjct: 13 TITYYHPMSIGLLVHPLSPHIPPASSPSASTAGNHHQRIFSLAETCSDM 61 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 460 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 600 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,059,184 Number of Sequences: 28952 Number of extensions: 307574 Number of successful extensions: 776 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -