BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0084 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.5 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 7.3 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 9.7 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 450 SDLRTICTLAVSFVICLMSV 391 S +T CTL + V C +++ Sbjct: 401 SKTKTFCTLVTALVYCSLAI 420 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -3 Query: 627 VAINTIELKICIIAVDASDN*RAIKQIFNFTMNDSDINSLQSTLITFC 484 + +NTI L + + R I +NDS + T +TFC Sbjct: 180 LVVNTINLTFLTLLMILEGRFRVINDGIQALINDSRKVTRFPTELTFC 227 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +3 Query: 270 YFWTDLICLLLKSANVIHNLI*VLFKQNII 359 Y+W ++ CL L + N +Q I+ Sbjct: 55 YYWLNVCCLNLSIVTIFFNFATKKLEQFIV 84 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,485 Number of Sequences: 336 Number of extensions: 2752 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -