BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0081 (614 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.18 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.42 SB_17384| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.56 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 31 0.98 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.98 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.7 SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_52475| Best HMM Match : Herpes_teg_N (HMM E-Value=2.3) 29 3.0 SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.0 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.0 SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.0 SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) 29 3.0 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 4.0 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) 29 4.0 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.2 SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.2 SB_2510| Best HMM Match : zf-C2H2 (HMM E-Value=6.1e-15) 28 5.2 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.9 SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.9 SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 6.9 SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_56992| Best HMM Match : Copper-bind (HMM E-Value=0.82) 27 9.1 SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_22443| Best HMM Match : Prosystemin (HMM E-Value=6.7) 27 9.1 SB_21384| Best HMM Match : 7tm_1 (HMM E-Value=8.6e-05) 27 9.1 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 9.1 SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_6634| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEP 610 +C +CDEEFH+ LMTHI + P Sbjct: 59 KCSICDEEFHDWNALMTHIRNQKNNP 84 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 31.9 bits (69), Expect = 0.42 Identities = 21/69 (30%), Positives = 32/69 (46%) Frame = +2 Query: 401 DDLDDIPLKNIKKEIQPEETVSMEKYYFGKLGSDEPGPRVAIAVQCPVCDEEFHNNITLM 580 D+ D K ++ + ++YY+ + DEP +QC VC EEF + L Sbjct: 644 DEKKDDAKKQEDEDAEEGADDGYDEYYYDE---DEP-------LQCEVCKEEFTSETKLR 693 Query: 581 THIYSHVVE 607 H+ SH VE Sbjct: 694 KHLSSHKVE 702 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 CP+C+ F L TH+ +H E P Sbjct: 848 CPLCERAFAKGYNLKTHMRTHTGEKP 873 >SB_17384| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 425 Score = 31.5 bits (68), Expect = 0.56 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +CP+C EF TL HI +H + P Sbjct: 318 KCPICGREFAQTTTLSNHIRTHTGQKP 344 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 30.7 bits (66), Expect = 0.98 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +CP CD+ F+ L HI+ H + P Sbjct: 582 KCPYCDKGFNQKSNLQAHIFGHTGQRP 608 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 30.7 bits (66), Expect = 0.98 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C +CD+ F + L HIY+H E P Sbjct: 1086 KCSMCDKAFRHPFGLQQHIYTHTGERP 1112 Score = 30.7 bits (66), Expect = 0.98 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 C CD+ F I+L TH Y H E P Sbjct: 1143 CKHCDKSFATTISLKTHTYIHTGEKP 1168 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 C VCD+EF + L+ H H+ E P Sbjct: 509 CSVCDKEFRSKTALINHQVKHLDERP 534 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 CP CD F N L H SH E P Sbjct: 452 CPTCDRVFQTNANLERHQASHSEERP 477 >SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 C VCD+EF + L+ H H+ E P Sbjct: 441 CSVCDKEFRSKTALINHQVKHLDERP 466 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 CP CD F N L H SH E P Sbjct: 384 CPTCDRVFQTNANLERHQASHSEERP 409 >SB_52475| Best HMM Match : Herpes_teg_N (HMM E-Value=2.3) Length = 177 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 365 RRSRKQPKTYVDDDLDDIPLKNIKKEIQPEETVSMEK 475 R S K P + +D+DDI L K+ Q +E + + K Sbjct: 25 RASSKSPLLWTPEDMDDIILTGDKRHRQTQEKMGLSK 61 >SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 336 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVE 607 +C VC++ F+ + TL TH+ +H E Sbjct: 225 KCEVCNKSFNRSSTLKTHVRTHSEE 249 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSH 598 +CP CD+ F N TL H+ H Sbjct: 292 KCPTCDKAFIRNYTLQCHMLIH 313 >SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 531 Score = 29.1 bits (62), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C +CD+EF + IT H H E P Sbjct: 165 KCDICDKEFISAITFKRHAIVHTGEKP 191 >SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) Length = 594 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -1 Query: 608 APPRGYRCGSS-GLCCCGTPRHRPGIVLQWPP 516 A G++ G+S CCC H PGIV Q P Sbjct: 36 AHTNGHKGGTSKSPCCCSHENHLPGIVYQHIP 67 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 28.7 bits (61), Expect = 4.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C C ++FH + H Y+H E P Sbjct: 176 ECEFCGKKFHQKSDMKKHTYTHTGEKP 202 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSH 598 QC VC++ F + TL TH+ H Sbjct: 148 QCNVCEKAFKRSSTLSTHMLIH 169 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 28.7 bits (61), Expect = 4.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSH 598 C CD+ F ++ L+ H+YSH Sbjct: 1010 CKKCDKRFAHSTVLLRHLYSH 1030 >SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) Length = 824 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSHVVEPP 613 CP C++ F N L HI +H E P Sbjct: 685 CPFCNKAFAENRCLQVHIRTHTGERP 710 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 524 IAVQCPVCDEEFHNNITLMTHIYSHVVEP 610 I V+CP C + F + L H+ SH EP Sbjct: 674 IKVRCPQCRDSFDHPRVLSMHLKSHHSEP 702 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C VCD F + TH+Y H E P Sbjct: 481 KCEVCDRAFTRRDEMHTHMYIHKGEKP 507 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C +C + F L TH+Y H E P Sbjct: 537 KCKLCPKSFTQYRNLQTHMYKHTGERP 563 >SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 684 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +CPVC + F L H SH+ E P Sbjct: 38 ECPVCGKSFLYPCALKRHAASHLTEKP 64 >SB_2510| Best HMM Match : zf-C2H2 (HMM E-Value=6.1e-15) Length = 230 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 QC C++EF N+ L H+ H E P Sbjct: 169 QCTHCEKEFKNSYELGRHVRVHTGEKP 195 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHV-VEP 610 +C C + F++ I L HIYSH V+P Sbjct: 877 KCNFCGKGFNDKIVLEKHIYSHTGVKP 903 >SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 615 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/75 (21%), Positives = 32/75 (42%) Frame = +2 Query: 389 TYVDDDLDDIPLKNIKKEIQPEETVSMEKYYFGKLGSDEPGPRVAIAVQCPVCDEEFHNN 568 T D+ +++ + +I++E + + + + K S P +CP C + F Sbjct: 326 TQTGDEKEEVIVGSIREE---QRSTKIGQLSIKKSNSKTPADDRTRDHECPTCAKRFFTK 382 Query: 569 ITLMTHIYSHVVEPP 613 L H ++H E P Sbjct: 383 NDLKRHGFTHSTERP 397 >SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 QC +C++ F TL+ HI +H E P Sbjct: 382 QCHLCEKAFTKPATLVDHIRTHSSERP 408 Score = 27.5 bits (58), Expect = 9.1 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +CP+C F + L H+ +H + P Sbjct: 354 RCPICQRHFSRRVGLRFHVQAHSGDKP 380 >SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 330 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSH 598 +C +C++ F+ + TL THI +H Sbjct: 220 KCHICNKAFNRSSTLKTHIRTH 241 >SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 524 IAVQCPVCDEEFHNNITLMTHIYSHVVE 607 + C +C++ F +L +H+YSH E Sbjct: 278 VPYNCSLCEKSFAKKRSLKSHMYSHSTE 305 >SB_56992| Best HMM Match : Copper-bind (HMM E-Value=0.82) Length = 1642 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 395 VDDDLDDIPLKNIKKEIQPEETVSMEKYYFGKLGSDEP 508 V+DDLD+ ++++ + +P E S E + GS EP Sbjct: 1440 VEDDLDESAERDVETDGKPYENKSTEPHDEHDTGSQEP 1477 >SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +CP C++ F + L TH+ H E P Sbjct: 410 KCPYCEKAFTASSILRTHVRQHSGEKP 436 >SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 365 RRSRKQPKTYVDDDLDDIPLKNIKKEIQPEETVSMEKYYF 484 R S K P + +D+DDI L +K + +E ++ K F Sbjct: 1557 RASGKSPLLWTPEDMDDIILTGDRKHRETQEKMNRSKTSF 1596 >SB_22443| Best HMM Match : Prosystemin (HMM E-Value=6.7) Length = 274 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 395 VDDDLDDIPLKNIKKEIQPEETVSMEKYYFGKLGSDEP 508 V+DDLD+ ++++ + +P E S E + GS EP Sbjct: 72 VEDDLDESAERDVETDGKPYENKSTEPHDEHDTGSQEP 109 >SB_21384| Best HMM Match : 7tm_1 (HMM E-Value=8.6e-05) Length = 442 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/61 (21%), Positives = 25/61 (40%) Frame = +2 Query: 380 QPKTYVDDDLDDIPLKNIKKEIQPEETVSMEKYYFGKLGSDEPGPRVAIAVQCPVCDEEF 559 QP + + + +N ++ E ++ E+Y G S PR+ + P C + Sbjct: 322 QPSCFARHNTRRVYARNNRRYFMRESDINPERYIVGNNKSISQSPRILVPAAKPRCAQVG 381 Query: 560 H 562 H Sbjct: 382 H 382 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 536 CPVCDEEFHNNITLMTHIYSH 598 CP C FH I L++H+ +H Sbjct: 332 CPECGRAFHARIGLVSHLRTH 352 >SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 594 Score = 27.5 bits (58), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 533 QCPVCDEEFHNNITLMTHIYSHVVEPP 613 +C +C+++F L H+ HV E P Sbjct: 295 KCEMCEQDFPGQTELAEHVRKHVGEKP 321 >SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 464 SMEKYYFGKLGSDEPGPRVAIAVQCPVCDEEFHNNITLMTHIYSHVVEP 610 + E F + + PG ++ QC VC + F+ T+ H+ SH P Sbjct: 11 AQESRVFTNVETLTPGQKL---FQCTVCGKVFNRKYTMQRHMRSHSDNP 56 >SB_6634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 424 EEHQEGDPTRGDRVDGEVLLREARQ*RARTQGGHCSTMPGL*RGVPQQHNPDDPHL 591 E H EG + + V E +R RAR +GG G RG+ + NPD+ L Sbjct: 6 EAHPEGSSSSDESVGEEATSSASRPVRARGRGG------GRRRGLHRAQNPDNTAL 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,934,903 Number of Sequences: 59808 Number of extensions: 228796 Number of successful extensions: 861 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -