BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0075 (395 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.07 |pup1||20S proteasome component beta 2|Schizosacchar... 27 1.4 SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces ... 25 4.3 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 24 9.8 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 24 9.8 >SPAC23D3.07 |pup1||20S proteasome component beta 2|Schizosaccharomyces pombe|chr 1|||Manual Length = 267 Score = 26.6 bits (56), Expect = 1.4 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +2 Query: 17 NCEQ*NKRAPECLWDCGHVLRTYTGVVHARFHARLFIESE*YNGEPGPGYCLSFFDFLLF 196 NC++ + +P +W G T V + + + + S N +P L+ LF Sbjct: 65 NCKKLHLISPN-IWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLF 123 Query: 197 RWVDKLTNYLVLSGY 241 R+ + YLVL GY Sbjct: 124 RYQGHIGAYLVLGGY 138 >SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 25.0 bits (52), Expect = 4.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 184 FPIV*MGGQAHELPSVKWLPEPIDIYNVNAAT 279 +P+V MG A L ++ +LP+ I I+ A T Sbjct: 140 WPVVFMGVLATVLVNIGFLPQYISIFRARAVT 171 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 23.8 bits (49), Expect = 9.8 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 77 RTYTGVVHARFHA-RLFIES 133 RT GV+H +FHA RL + S Sbjct: 294 RTVYGVIHKKFHAVRLTLRS 313 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 23.8 bits (49), Expect = 9.8 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -3 Query: 201 HLNNRKSKNERQ*PGPGSPLYHSLSIKSRA*KRACTTPV*VRRTCPQ 61 H+N + + P G P S SI R ++P RR CP+ Sbjct: 386 HVNKNAAADRTTSPTQGQPESPSKSILLRPPPSIASSPESKRRKCPK 432 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,643,172 Number of Sequences: 5004 Number of extensions: 30967 Number of successful extensions: 83 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 132093910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -