BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0075 (395 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0137 + 1005818-1006852,1007645-1007827,1008398-1008616,100... 27 7.2 02_05_1351 - 35855543-35856751 27 7.2 01_06_1536 + 38075023-38075359,38075834-38075963,38076204-380764... 27 7.2 01_01_0615 - 4576554-4576560,4577808-4577824,4578776-4578911,457... 27 7.2 12_02_0318 - 17457182-17462232,17462745-17462955,17463356-174634... 26 9.6 07_01_0146 - 1068314-1068656,1069349-1069507,1069642-1069835 26 9.6 05_01_0548 - 4778099-4778121,4780881-4781661 26 9.6 >07_01_0137 + 1005818-1006852,1007645-1007827,1008398-1008616, 1008682-1008690 Length = 481 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 145 WRTRSWLLPLIF*FPIV*MGGQAHELPSVKWL 240 W+T LL + I + G HE+ VKWL Sbjct: 423 WKTEELLLKFLHEVEINNLRGTGHEIALVKWL 454 >02_05_1351 - 35855543-35856751 Length = 402 Score = 26.6 bits (56), Expect = 7.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 205 GQAHELPSVKWLPEP 249 G ++ LP+V WLPEP Sbjct: 89 GASYNLPAVLWLPEP 103 >01_06_1536 + 38075023-38075359,38075834-38075963,38076204-38076419, 38076520-38077137,38077226-38078075 Length = 716 Score = 26.6 bits (56), Expect = 7.2 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 47 ECLWDCGHV-LRTYTGVVHARFHARLFIESE*YNGEPGPGYCLSFFDFLLFRWVDKLTNY 223 E L +CG++ L T ++HA HA + NG G CL+ D + F W D+L Sbjct: 167 EELEECGYMHLDDNTHLLHAVVHANGYGHLLRVNGREGGSRCLTGRDIMSF-W-DRLCKV 224 Query: 224 L 226 L Sbjct: 225 L 225 >01_01_0615 - 4576554-4576560,4577808-4577824,4578776-4578911, 4579488-4579543,4580540-4580635,4580864-4580927, 4581022-4581077,4581170-4581249,4581778-4581842, 4581970-4582177,4582889-4583447 Length = 447 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 113 RENARVQRPCRCAGHA 66 RE ARV+ C CA HA Sbjct: 161 REEARVEEECPCASHA 176 >12_02_0318 - 17457182-17462232,17462745-17462955,17463356-17463403, 17466161-17466346 Length = 1831 Score = 26.2 bits (55), Expect = 9.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 110 HARLFIESE*YNGEPGPGYCLSFFDFLLFRWVDKLTNYL 226 + RL+I + P P C +FF+F+ W ++ YL Sbjct: 1538 YCRLWIMWQNSKSTPTPKDCAAFFEFVDKNWNTEIGKYL 1576 >07_01_0146 - 1068314-1068656,1069349-1069507,1069642-1069835 Length = 231 Score = 26.2 bits (55), Expect = 9.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 78 APTRALYTRVFTLDFLSKVSDIMANPVLVI 167 APT L+ +FT LSK A P +++ Sbjct: 77 APTAELFDAIFTATILSKTVQTAAGPKMMV 106 >05_01_0548 - 4778099-4778121,4780881-4781661 Length = 267 Score = 26.2 bits (55), Expect = 9.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 104 ARVQRPCRCAGHARSPTSTRALVCF 30 A RPC C RSPTS L F Sbjct: 41 AAAARPCECDSPVRSPTSPLDLRAF 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,835,740 Number of Sequences: 37544 Number of extensions: 214741 Number of successful extensions: 487 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 684860244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -