BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0075 (395 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10633| Best HMM Match : LMWPc (HMM E-Value=0.64) 29 1.4 SB_25422| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 >SB_10633| Best HMM Match : LMWPc (HMM E-Value=0.64) Length = 377 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -2 Query: 391 SLRKKKSIYFRSRSQLRLQVV*RYANHLTIPLTTIHFRWRHLRCRCLWAPV 239 S K + FR +Q+R++V + +T+P + R R + R +W V Sbjct: 271 SFESKMVVSFRVGNQMRVEVAKGSGSWITVPENATNIRVRFMANRLVWCDV 321 >SB_25422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 26.6 bits (56), Expect = 7.3 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = -3 Query: 213 SLSTHLNNRKSKNERQ*PG----PGSPLYHSLSIKSRA*KRACTTPV*VRRTCPQSHKHS 46 SL +H +K+K + + P P SP +S+S+ + TTPV +++ CP ++ S Sbjct: 165 SLESHEQEKKAKKKNKQPKIKHEPESPKQNSMSM-------SITTPVNLKQECPTDYQSS 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,629,899 Number of Sequences: 59808 Number of extensions: 251279 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -