BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0073 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 3.4 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 3.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 3.4 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 21 7.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.8 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 268 KYDYVFTYLHLFSNLFSAPGFYDIAK 191 KY V + L +FS P FY I K Sbjct: 398 KYQIVPSALEIFSTSMKDPAFYRIYK 423 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 268 KYDYVFTYLHLFSNLFSAPGFYDIAK 191 KY V + L +FS P FY I K Sbjct: 398 KYQIVPSALEIFSTSMKDPAFYRIYK 423 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 150 ILIYGILGLLKSTLLSFHYQEKEQGVFFSNAYI 52 ILI G+ ++ HY +E + N+Y+ Sbjct: 780 ILINGVWMIIDPAKAMHHYPTREDNLLVCNSYV 812 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 165 GDDSAILIYGILGLLKSTLLSFHYQ 91 GD + +YG L LL +L F Y+ Sbjct: 369 GDSVNVQLYGQLDLLVRKVLGFGYE 393 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 338 VVPTYL*MNKLIRELELFKFEFTEI 264 +VPT +NK + LELF T I Sbjct: 85 IVPTTQEINKPFKRLELFNITTTTI 109 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 165 GDDSAILIYGILGLLKSTLLSFHYQ 91 GD + +YG L LL +L F Y+ Sbjct: 369 GDSVNVQLYGQLDLLVRKVLGFGYE 393 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 407 LICTNTIVRKFVHFKRKC 460 L C + + RKF+H +C Sbjct: 115 LTCEDDVHRKFLHVNDEC 132 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 42 LNLKCRHLKRTP 77 LN KC L+RTP Sbjct: 351 LNTKCNTLERTP 362 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,563 Number of Sequences: 438 Number of extensions: 3048 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -