BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0070 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0180 - 2037656-2037858,2038517-2038579,2038909-2039782 29 3.4 03_01_0414 + 3183292-3183735,3184547-3184969,3185435-3185535,318... 29 4.5 >10_01_0180 - 2037656-2037858,2038517-2038579,2038909-2039782 Length = 379 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -2 Query: 159 RYK*RSSTNHIHLAQHPDKVEYILYTPGAAFRQDRLQTIYTWRSIAAHS 13 R + R+ T + L H D V + Y G A + RLQT W I A S Sbjct: 84 RRRSRAETAVLRLCAHGDHVVFYGYLTGDANQVQRLQTTRHWACIDALS 132 >03_01_0414 + 3183292-3183735,3184547-3184969,3185435-3185535, 3186178-3187439,3187625-3187665,3187777-3187845, 3187975-3188075,3188413-3188491,3188570-3188668, 3188757-3188825,3188918-3188967,3189211-3189387, 3189496-3189634 Length = 1017 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -2 Query: 222 YGEIKKGLYTNSLIGDPDVIDRYK 151 YG++ KGL TNS +GD I+R+K Sbjct: 627 YGDLDKGL-TNSRLGDQPPIERHK 649 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,380,347 Number of Sequences: 37544 Number of extensions: 312529 Number of successful extensions: 624 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -