BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0070 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39851-5|AAZ32802.1| 408|Caenorhabditis elegans Hypothetical pr... 31 0.56 U39851-4|AAZ32803.1| 572|Caenorhabditis elegans Hypothetical pr... 31 0.56 U39851-3|AAZ32804.1| 563|Caenorhabditis elegans Hypothetical pr... 31 0.56 Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical pr... 28 6.9 DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-t... 28 6.9 AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-t... 28 6.9 AF045640-7|AAU05589.1| 978|Caenorhabditis elegans Novel channel... 28 6.9 AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel... 28 6.9 AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel... 28 6.9 >U39851-5|AAZ32802.1| 408|Caenorhabditis elegans Hypothetical protein C23G10.7a protein. Length = 408 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = -1 Query: 634 DLNILLKFVKKFDGTREHNENIQKTNSKHVVLLPTSIDFDESNRYIPEIIGEYLILKNF* 455 D +I L+F+K+ + ++EH E ++K K + ID +S+R ++ + +K + Sbjct: 138 DTSIQLQFLKQANSSQEHFEFMKKQAFKQLYTWLKGIDLSKSSRKTNSLLDKESYIKTYR 197 Query: 454 H 452 H Sbjct: 198 H 198 >U39851-4|AAZ32803.1| 572|Caenorhabditis elegans Hypothetical protein C23G10.7b protein. Length = 572 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = -1 Query: 634 DLNILLKFVKKFDGTREHNENIQKTNSKHVVLLPTSIDFDESNRYIPEIIGEYLILKNF* 455 D +I L+F+K+ + ++EH E ++K K + ID +S+R ++ + +K + Sbjct: 138 DTSIQLQFLKQANSSQEHFEFMKKQAFKQLYTWLKGIDLSKSSRKTNSLLDKESYIKTYR 197 Query: 454 H 452 H Sbjct: 198 H 198 >U39851-3|AAZ32804.1| 563|Caenorhabditis elegans Hypothetical protein C23G10.7c protein. Length = 563 Score = 31.5 bits (68), Expect = 0.56 Identities = 16/61 (26%), Positives = 33/61 (54%) Frame = -1 Query: 634 DLNILLKFVKKFDGTREHNENIQKTNSKHVVLLPTSIDFDESNRYIPEIIGEYLILKNF* 455 D +I L+F+K+ + ++EH E ++K K + ID +S+R ++ + +K + Sbjct: 138 DTSIQLQFLKQANSSQEHFEFMKKQAFKQLYTWLKGIDLSKSSRKTNSLLDKESYIKTYR 197 Query: 454 H 452 H Sbjct: 198 H 198 >Z81576-5|CAB04646.2| 1696|Caenorhabditis elegans Hypothetical protein R10E8.6 protein. Length = 1696 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +3 Query: 321 YLTHYKLFLCFKYLAVKRYRVTDYILFPTSRAFRLTHNK 437 +L LFL L K+Y++ ++ P +R F +++ K Sbjct: 250 FLKEVSLFLVLNQLLSKKYKLQHFLESPNAREFLISYRK 288 >DQ917240-1|ABI94563.1| 1797|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1797 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 103 LVWMLRQVYMVCTRSLFVTIDHVG 174 L WMLR +Y C +FV I+ +G Sbjct: 392 LQWMLRSMYFQCFVIIFVVINAIG 415 >AY555271-1|AAS65871.2| 1831|Caenorhabditis elegans four domain-type voltage-gatedion channel alpha-1 subunit protein. Length = 1831 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 103 LVWMLRQVYMVCTRSLFVTIDHVG 174 L WMLR +Y C +FV I+ +G Sbjct: 392 LQWMLRSMYFQCFVIIFVVINAIG 415 >AF045640-7|AAU05589.1| 978|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform b protein. Length = 978 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 103 LVWMLRQVYMVCTRSLFVTIDHVG 174 L WMLR +Y C +FV I+ +G Sbjct: 450 LQWMLRSMYFQCFVIIFVVINAIG 473 >AF045640-6|AAU05588.1| 1562|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform a protein. Length = 1562 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 103 LVWMLRQVYMVCTRSLFVTIDHVG 174 L WMLR +Y C +FV I+ +G Sbjct: 450 LQWMLRSMYFQCFVIIFVVINAIG 473 >AF045640-4|AAU05590.1| 1861|Caenorhabditis elegans Novel channel type/putative nematodecalcium channel protein 1, isoform d protein. Length = 1861 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 103 LVWMLRQVYMVCTRSLFVTIDHVG 174 L WMLR +Y C +FV I+ +G Sbjct: 422 LQWMLRSMYFQCFVIIFVVINAIG 445 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,879,461 Number of Sequences: 27780 Number of extensions: 306715 Number of successful extensions: 802 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -