Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0066
         (310 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     27   0.039
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             24   0.48 
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    20   7.8  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    20   7.8  
AF388659-1|AAK71995.1|  782|Apis mellifera 1D-myo-inositol-trisp...    20   7.8  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 27.5 bits (58), Expect = 0.039
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -1

Query: 265 YNTEWSAAPHRHFGSFRSTNSAFRFLKHQSSFSSNASLATKGSTSKL 125
           +N ++S  P+  FG F         +K  +  +    L+ KGS SKL
Sbjct: 214 HNDKYSNVPYFLFGDFNFRTDTAGVIKKLTEDTQERRLSNKGSISKL 260


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 23.8 bits (49), Expect = 0.48
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -3

Query: 149  DEGLDE*TNPQTPMSFSPNLLSGSRFQSGGR 57
            D+G D  T+P TP+S S    +GSR +   R
Sbjct: 1388 DDGSDRLTSPPTPLSIS---RAGSRDEDSTR 1415


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 19.8 bits (39), Expect = 7.8
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 75  TRPTEKIWRET 107
           T+P   +WRET
Sbjct: 395 TKPRYMVWRET 405


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 19.8 bits (39), Expect = 7.8
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 75  TRPTEKIWRET 107
           T+P   +WRET
Sbjct: 310 TKPRYMVWRET 320


>AF388659-1|AAK71995.1|  782|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
          Length = 782

 Score = 19.8 bits (39), Expect = 7.8
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 75  TRPTEKIWRET 107
           T+P   +WRET
Sbjct: 629 TKPRYMVWRET 639


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,570
Number of Sequences: 438
Number of extensions: 1427
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  6471036
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)