BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0058 (423 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) 173 7e-44 SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) 28 2.8 SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) 28 3.7 SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) 28 3.7 SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) 27 4.8 SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) 27 4.8 SB_59285| Best HMM Match : SecIII_SopE_N (HMM E-Value=3.7) 27 6.4 SB_55508| Best HMM Match : Glyco_hydro_67N (HMM E-Value=5.4) 27 6.4 SB_52261| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 27 6.4 SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_902| Best HMM Match : Collagen (HMM E-Value=0.00027) 27 6.4 SB_38544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_19135| Best HMM Match : Ribosomal_L13e (HMM E-Value=0) Length = 600 Score = 173 bits (420), Expect = 7e-44 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 1/136 (0%) Frame = +1 Query: 13 KGNNMIPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPT 192 K NN+IPNGHFHKDWQR+VKTWF+QP R+ RR+ R LRPIVRCPT Sbjct: 4 KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQIKAAKIAPRPVAGSLRPIVRCPT 63 Query: 193 VRYHTKVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRAR 372 +Y+TKVRAGRGFTL E++AAG+ A TIGIAVD RR+N+S ESLQ NVQR+KEY+++ Sbjct: 64 FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSK 123 Query: 373 LILFP-KGKKVLKGDA 417 LI+FP K K +GD+ Sbjct: 124 LIVFPRKANKPKQGDS 139 >SB_47063| Best HMM Match : APOBEC_C (HMM E-Value=0.41) Length = 430 Score = 28.3 bits (60), Expect = 2.8 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 180 +GS V ++T NP L++R N +P R +L+W++ G + Sbjct: 375 KGSWVALTVESSTLANPNILLARIQNLMPGRKASLLWFKATGKK 418 >SB_58892| Best HMM Match : IncA (HMM E-Value=1.3) Length = 449 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 159 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 176 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 226 >SB_32771| Best HMM Match : IncA (HMM E-Value=1.4) Length = 318 Score = 27.9 bits (59), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHRTIGRNGP 159 +GS V +T NP L++R N +P R +L+W++ + + + P Sbjct: 66 KGSWVALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEKGLKSDNP 116 >SB_54753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -1 Query: 138 GLSFLYSILLSAVSSSWLVKPSFNKSLPI 52 G F +IL+ A SS L++P F+ SLP+ Sbjct: 195 GFDFGKAILVKASLSSDLIRPGFDVSLPL 223 >SB_18936| Best HMM Match : Glyco_hydro_67N (HMM E-Value=7) Length = 154 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 180 +GS A V +T NP L++R N +P R +L+W++ + Sbjct: 60 KGSWAALTVEGSTLANPNILLARIQNLMPGRKASLLWFKATAEK 103 >SB_6638| Best HMM Match : CaMBD (HMM E-Value=5.1) Length = 165 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 180 +GS V ++T NP L++R N +P R L+W++ G + Sbjct: 110 KGSWVALTVESSTLANPNILLARIQNLMPGRKALLLWFKATGKK 153 >SB_59285| Best HMM Match : SecIII_SopE_N (HMM E-Value=3.7) Length = 204 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 180 +GS V +T NP+ L++R N +P R +L+W++ + Sbjct: 110 KGSWVALTVEGSTLANPSILLARIQNLMPGRKASLLWFKATAEK 153 >SB_55508| Best HMM Match : Glyco_hydro_67N (HMM E-Value=5.4) Length = 154 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 305 RGSTAIPIVRANTGFNPAALISRRVNPLPAR--TLVWYRTVGHR 180 +GS V +T NP+ L++R N +P R +L+W++ + Sbjct: 60 KGSWVALTVEGSTLANPSILLARIQNLMPGRKASLLWFKATAEK 103 >SB_52261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 27.1 bits (57), Expect = 6.4 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +1 Query: 199 YHTKVRA--GRGFTLREIRAAG 258 YHTK A GRG TL IRA G Sbjct: 519 YHTKKSAHQGRGITLSSIRAGG 540 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 159 SCRTWSYGLSFLYSILLSAVSSSWLV 82 SCRTW SF+ +L AV S+ L+ Sbjct: 199 SCRTWICSTSFMSPSILVAVGSAVLI 224 >SB_8046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 261 QSCGPNFTKSESSTGAYFSMVPNSWASHYRT*RP 160 + C P +T++ + GAY VP S +H T P Sbjct: 1173 ERCAPGYTRATPNGGAYTPCVPCSCNNHTDTCDP 1206 >SB_902| Best HMM Match : Collagen (HMM E-Value=0.00027) Length = 617 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 159 SCRTWSYGLSFLYSILLSAVSSSWLV 82 SCRTW SF+ +L AV S+ L+ Sbjct: 137 SCRTWICSTSFMSPSILVAVGSAVLI 162 >SB_38544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 935 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -1 Query: 162 PSCR--TWSYGLSFLYSILLSAVS 97 P+CR TWSY ++ L+ IL AVS Sbjct: 304 PTCRVSTWSYNMTCLHIILHYAVS 327 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,527,112 Number of Sequences: 59808 Number of extensions: 259203 Number of successful extensions: 820 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -