BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0053 (636 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5AEJ2 Cluster: Putative uncharacterized protein; n=1; ... 35 1.4 UniRef50_Q33575 Cluster: NADH-ubiquinone oxidoreductase chain 4;... 33 4.4 UniRef50_Q2SRZ2 Cluster: Membrane protein, putative; n=4; cellul... 33 5.8 >UniRef50_Q5AEJ2 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 470 Score = 35.1 bits (77), Expect = 1.4 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +1 Query: 481 QIEHNLLCQVWWLLLTSNSIFVNLFNK*HQRNPKKMSLHKNNVQVV 618 QI HNLL + L+ NS FV F + QRNP + H V+++ Sbjct: 39 QISHNLLSNALYSLIKKNSWFVQNFFQIDQRNPATANGHNFEVRIL 84 >UniRef50_Q33575 Cluster: NADH-ubiquinone oxidoreductase chain 4; n=3; Trypanosomatidae|Rep: NADH-ubiquinone oxidoreductase chain 4 - Trypanosoma brucei Length = 437 Score = 33.5 bits (73), Expect = 4.4 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = -2 Query: 332 NLLFINYLCWCKSMLFKLVYYAFPVG-EIHKIVLR-SIEKVSVRFLFLTYLAL*KRPVLR 159 NL+ IN++ ++++ + Y+F +G EI+ + + + +S+ F+F + ++ Sbjct: 5 NLICINFILLIVTIIYIYINYSFCIGIEINYVYVNIYLNYISLWFVFFMGI------IMY 58 Query: 158 ILILKSSSLGGFFKLYYYIFKAYVYLY 78 ILI S + Y+YI Y+Y+Y Sbjct: 59 ILIFLLSKKCVSYNKYFYIVMIYMYIY 85 >UniRef50_Q2SRZ2 Cluster: Membrane protein, putative; n=4; cellular organisms|Rep: Membrane protein, putative - Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC27343 / NCTC 10154) Length = 1404 Score = 33.1 bits (72), Expect = 5.8 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 4/58 (6%) Frame = +1 Query: 430 YANKVNKKIKRSQPLYSQIEHNLLCQVWWLL----LTSNSIFVNLFNK*HQRNPKKMS 591 + NK++KK R+ + S I++NL+ Q + LTSN + +L NK +QR K++ Sbjct: 825 FENKISKKANRNSLIKSSIKNNLIKQEYLKARIDELTSNQVLESLENKNNQRKIFKVN 882 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,130,379 Number of Sequences: 1657284 Number of extensions: 9461572 Number of successful extensions: 18963 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18871 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47296372782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -