BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0053 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1651 - 28395369-28395436,28395524-28395575,28395857-283960... 28 7.1 >07_03_1651 - 28395369-28395436,28395524-28395575,28395857-28396092, 28396362-28396419,28396509-28396577,28396686-28396791, 28397104-28397171,28397266-28397385,28398144-28398231, 28399433-28399534,28399699-28399757,28399866-28400003, 28400222-28400473,28400508-28400593,28401061-28401165, 28402351-28402516 Length = 590 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 121 KKPPRLEDFRMRILSTGLFYSAKYVRNKNLTDTFSIDLKTI 243 +KPP+ E F I TGL ++ +V + L TF++D+ ++ Sbjct: 492 RKPPKYERF---IRPTGLRFTKAHVTHPELKCTFNLDIISV 529 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,869,677 Number of Sequences: 37544 Number of extensions: 233972 Number of successful extensions: 446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -