BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0053 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 6.1 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 8.1 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 394 TTGFSNARGRAKLLPTVDIT 335 T G +ARGRAK L D T Sbjct: 775 TEGAVSARGRAKALADADFT 794 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 8.1 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = +2 Query: 338 NINGRKQLGSAPGIAEARSSRSVTTHHQVSRMPTRSIKK*NGVSRYTAK 484 N + R A G S+ S+ +H Q ++ NG++R+ +K Sbjct: 806 NSSERMLPSGATGNNSTNSAYSMQSHQQQQHHQPSAVSNSNGLARHNSK 854 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,076 Number of Sequences: 2352 Number of extensions: 10658 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -