BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0050 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 25 2.7 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 4.6 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 24.6 bits (51), Expect = 2.7 Identities = 21/82 (25%), Positives = 38/82 (46%) Frame = +1 Query: 376 VHPRVLIRAVRTASRLAIEKIKEQAVKIDNKSPEEQRDLLLKCASTAMSSKLIHQQKDHF 555 + P V R +R ++ E+ I+++SP + DLL++ + S K + + + Sbjct: 1 LEPLVTWRLNDKCNRYNEDEEDEEDDFINSQSPSNEVDLLIQIGNGIFSQKGT-KFDERY 59 Query: 556 SKIVVDAVLSLDTPLLPLDMIG 621 K+ D S L PLD +G Sbjct: 60 DKLAKDLYKS---ELKPLDFVG 78 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 40 PQILLLREGTDQTQGKPQLVSNINACQLVVDAVRT 144 P I LLR+ +QT+ + Q S++ L RT Sbjct: 354 PLIALLRQNCEQTRDRMQQTSDLQNRSLAAAQYRT 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,504 Number of Sequences: 2352 Number of extensions: 13544 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -