BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0049 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 1.6 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 25 2.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.7 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.4 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 8.4 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 8.4 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 650 GSINSPALKT*VLVYKRWVLDNE*F 576 G N P + T V Y RW+++N F Sbjct: 411 GEANHPGIYTRVSSYVRWIIENAVF 435 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 24.6 bits (51), Expect = 2.7 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = -2 Query: 262 SYRG--TIHLGSQAFLKTLTQN*LLHSCCRTFLS 167 +YRG T+ G++ F + + QN LL+ CCR+ +S Sbjct: 1 NYRGITTLSAGAKVF-EVVVQNSLLN-CCRSLIS 32 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.6 bits (51), Expect = 2.7 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = -3 Query: 603 ALGSG*RVIPEFPQHSSNEYSPPSSGMFSNFLAPGLGPLTADSALCSVSLIGFPATHCVI 424 ++G G +P+ P SS S PS+GM PG L S S++ +H + Sbjct: 590 SMGLGLPQVPQPPAGSSLNLSHPSAGMVPQPPPPG-SALGHPSIPTSLAAAAAAYSHSIA 648 Query: 423 TDTNNRH 403 + ++ H Sbjct: 649 STMSSYH 655 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = -2 Query: 478 QRPLQRLTHRFPGHALRYH*HEQQTFHYTNTVPARAP 368 Q+P + PGH+ +H H H++ + +P Sbjct: 167 QQPSSYHQQQHPGHSQHHHHHHHHHPHHSQQQHSASP 203 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = -3 Query: 564 QHSSNEYSPPSSGMFSNFLAPGLGPLTADSALCSVSLIGFPATHCVITDTNNRH 403 +HS + S + PG GPL A SA PA H + T ++H Sbjct: 469 RHSEKQQQQQSQHQQQHQHQPGGGPLPAQSAKQRTK--SKPAEHAGGSTTGDKH 520 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = -3 Query: 564 QHSSNEYSPPSSGMFSNFLAPGLGPLTADSALCSVSLIGFPATHCVITDTNNRH 403 +HS + S + PG GPL A SA PA H + T ++H Sbjct: 469 RHSEKQQQQQSQHQQQHQHQPGGGPLPAQSAKQRTK--SKPAEHAGGSTTGDKH 520 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,642 Number of Sequences: 2352 Number of extensions: 15612 Number of successful extensions: 19 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -