BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0049 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024853-4|AAK68586.1| 746|Caenorhabditis elegans Hypothetical ... 29 2.9 U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical pr... 28 6.6 >AC024853-4|AAK68586.1| 746|Caenorhabditis elegans Hypothetical protein Y71F9AR.3 protein. Length = 746 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -3 Query: 579 IPEFPQHSSNEYSPPSSGMFSNFLAPGL 496 +P P S E SPPSS FSN AP L Sbjct: 190 LPSTP--SEREASPPSSSQFSNSAAPNL 215 >U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical protein M01H9.2 protein. Length = 439 Score = 27.9 bits (59), Expect = 6.6 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = -3 Query: 576 PEFPQHSSNEYSPPSSGMFSNFLAPGLGPLTADSALCSVSLIGFPATHCVITDTNNRHFT 397 P++P N +P + FL PG L S ++L+G VI +H T Sbjct: 240 PQYPDEKLNTIAPNPMQLVEPFLTPGQNDLNPKSMSSLINLLGCKDKDEVIC----KHVT 295 Query: 396 TPT-LCRP 376 T L RP Sbjct: 296 ADTCLSRP 303 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,191,106 Number of Sequences: 27780 Number of extensions: 325726 Number of successful extensions: 908 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -