BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0048 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 31 1.2 SB_37820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 667 INFEFNNTKKKFITSVHAPYPDAAIL*NCFFFSVNTF 557 I E K K T H+PY + + NCFFF++N F Sbjct: 26 IQDERRRRKSKGYTLEHSPYSEVSPR-NCFFFAINRF 61 >SB_37820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 644 QKKIYHVRSRAIS*CRHFIKLL 579 QKK+YHVRS+A R +KLL Sbjct: 381 QKKVYHVRSKAAREIRDLMKLL 402 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,496,597 Number of Sequences: 59808 Number of extensions: 282271 Number of successful extensions: 510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -