BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0048 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.2 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.6 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 24.2 bits (50), Expect = 1.2 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 633 LSRPFTRHILMPPFYKIAFFF 571 ++RP T+ I +PP Y++ +F Sbjct: 149 ITRPDTKFIQLPPLYEMCPYF 169 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 24.2 bits (50), Expect = 1.2 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 633 LSRPFTRHILMPPFYKIAFFF 571 ++RP T+ I +PP Y++ +F Sbjct: 149 ITRPDTKFIQLPPLYEMCPYF 169 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 530 HY*AYYVVKKCIYGKKKAIL*NGGIRIWRVNGR 628 +Y Y K Y KK+ ++ NG + + ++GR Sbjct: 462 YYSHYVAFKSLSYLKKQPVIANGSLEVDVIDGR 494 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,550 Number of Sequences: 438 Number of extensions: 3165 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -