BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0045 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.1 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 3.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 3.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 3.7 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 8.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 8.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.6 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 408 ININNTKQRKPLLRIF 455 ININ+ K+ K ++RIF Sbjct: 505 ININSDKETKGMMRIF 520 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 408 ININNTKQRKPLLRIF 455 ININ+ K+ K ++RIF Sbjct: 505 ININSDKETKGMMRIF 520 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 306 VSNKTS*NNNRIKLYK*NNKHETK*IVSVAVKAFININNTKQ 431 +SNKT NNN K NN + K + NIN +Q Sbjct: 85 LSNKTIHNNNNYKYNYNNNNYNNN-----CKKLYYNINYIEQ 121 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 306 VSNKTS*NNNRIKLYK*NNKHETK*IVSVAVKAFININNTKQ 431 +SNKT NNN K NN + K + NIN +Q Sbjct: 85 LSNKTIHNNNNYKYNYNNNNYNNN-----CKKLYYNINYIEQ 121 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 3.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 306 VSNKTS*NNNRIKLYK*NNKHETK*IVSVAVKAFININNTKQ 431 +SNKT NNN K NN + K + NIN +Q Sbjct: 85 LSNKTIHNNNNYKYNYNNNNYNNN-----CKKLYYNINYIEQ 121 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 575 LLPYESRATRKMTPPDPTENTNSTFFYDTI 664 LLP + + KM PP +F+ T+ Sbjct: 40 LLPEDPKLYDKMRPPKKDGQATVVYFHVTV 69 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 94 YNNNYNNYNKHNYNKL 109 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 327 YNNNYNNYNKHNYNKL 342 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 56 YNNRRNSLKKHSCDKI 9 YNN N+ KH+ +K+ Sbjct: 327 YNNNYNNYNKHNYNKL 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,078 Number of Sequences: 438 Number of extensions: 3887 Number of successful extensions: 25 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -