BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0038 (427 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0049 + 11889214-11890302 29 2.1 10_08_0022 - 14225725-14226472,14227997-14228420,14228516-14228573 27 8.3 >09_03_0049 + 11889214-11890302 Length = 362 Score = 28.7 bits (61), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 277 AAPPFKPKPHYCFTAEIGGAVVPTRADSQEVLP 179 AAPPF KP T E GG+V + + Q++LP Sbjct: 300 AAPPFDVKPELPATMEHGGSVFVEQPE-QKILP 331 >10_08_0022 - 14225725-14226472,14227997-14228420,14228516-14228573 Length = 409 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 331 NAPHTLRYKL*GLSIVTTAAPPFKPKPHYC 242 N P LR++ +S VTTAAP + + + C Sbjct: 62 NLPWKLRHRAAAVSAVTTAAPAPRKRVYVC 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,398,958 Number of Sequences: 37544 Number of extensions: 247104 Number of successful extensions: 500 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 790518168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -