BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0037 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_17043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = -1 Query: 429 RDGVTM*SLFLIQMTLCIFIVNLIQSFTYF*IH*FTPSYNIYKIIASFRFPQVFCEMGTF 250 +DG+ +LF + C+FIV I+ F + T +N+ K+ F +V C Sbjct: 100 KDGIGQGTLFNVIKVTCVFIV--IKVTCVFNVIKVTCVFNVIKVTCVFNVIKVTCVFNVI 157 Query: 249 VCTSLF 232 T +F Sbjct: 158 KVTCVF 163 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 140 WRLFGQLLMETKNHPREIRNVFWLFWFHLPWNSEV 244 WRLF L+ E + +FW+H+ + EV Sbjct: 1935 WRLFHPLMSEPNIAVHHNKQALLIFWYHVCMDCEV 1969 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,473,180 Number of Sequences: 59808 Number of extensions: 339290 Number of successful extensions: 633 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -