BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0035 (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 3.3 SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 26 5.8 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 26.6 bits (56), Expect = 3.3 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -1 Query: 501 NVCVVRVIFFFLCILHTGFVCTNKLDWC 418 N+C+ ++ C HT + + +LD+C Sbjct: 65 NICLASFLYLSKCYYHTHILTSVRLDFC 92 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 25.8 bits (54), Expect = 5.8 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 236 NRNALLLHG*NRQGGGTYPCGL--TRGPTTSKGSFRLASFL 352 N ++LHG N Q CGL T+K ASFL Sbjct: 106 NGELIVLHGINHQAAMLTACGLFMVTSSNTNKWKIAFASFL 146 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,703,581 Number of Sequences: 5004 Number of extensions: 56255 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -