BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0032 (425 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 30 0.040 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.1 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 1.1 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 2.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 3.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 4.5 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 4.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 4.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 4.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 22 7.9 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 22 7.9 AF457550-1|AAL68780.1| 92|Anopheles gambiae antigen 5-related ... 22 7.9 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 22 7.9 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 29.9 bits (64), Expect = 0.040 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 30 CTGVRISLAGTNFSNEIRTQQMFTIDFHGEGITSCNKNQTRKIIICVITG 179 C+G +S + + QQ +I H EG+ + RK ++C ITG Sbjct: 103 CSGYDLS----ELAGQQEPQQALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 1.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 307 YLKVCGSFTL*MSMGSSNHLTPGG 378 Y K+CGS S S N L+PGG Sbjct: 165 YQKICGSNIPQASGHSKNSLSPGG 188 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.0 bits (52), Expect = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +1 Query: 232 LP*SSNAFR--FEGWGSRCDYTETLELYLK 315 LP N R F W CDY + YLK Sbjct: 908 LPKQLNDIRLAFNAWSCECDYVTRFQEYLK 937 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 250 HYCFTAEIGGAVVPTRADSQEVLP 179 H F AEIG ++V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 42 RISLAGTNFSNEIRTQQMFTIDFHGEG 122 R AGT F + +++ F HGEG Sbjct: 286 RFQHAGTRFKTKQFSKENFLATLHGEG 312 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 4.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 60 TNFSNEIRTQQMFTIDFHGEGITSCNKNQTRKIIICVITGGRTSCESA 203 T+FS+ T + D +G+G TS + I + G ++ SA Sbjct: 618 TSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTVLAEGDKSVSASA 665 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 4.5 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = +3 Query: 60 TNFSNEIRTQQMFTIDFHGEGITSCNKNQTRKIIICVITGGRTSCESA 203 T+FS+ T + D +G+G TS + I + G ++ SA Sbjct: 619 TSFSSSGNTTVVSDYDVYGKGSTSTTTSSAGTICTVLAEGDKSVSASA 666 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 4.5 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 268 WGSRCDYTETLELYLKV 318 WG C Y +YLKV Sbjct: 1286 WGKHCGYANKPGVYLKV 1302 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 4.5 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 268 WGSRCDYTETLELYLKV 318 WG C Y +YLKV Sbjct: 1286 WGKHCGYANKPGVYLKV 1302 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 104 NREHLLSTYFIRKIGTRQRDSN 39 N EH +T+F+RKI SN Sbjct: 326 NGEHKTNTHFMRKIPPGAEASN 347 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 22.2 bits (45), Expect = 7.9 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 36 GVRISLAGTNFSNEIRTQQMFTIDFHGEGITSCNKNQTRKIIICVITGGRTSCESAR 206 GVR+ A S T + DF +KN+ ++ +C+ T GR S + R Sbjct: 5 GVRLVTAALLLSVLFSTGSCYMRDF-------AHKNEINEMRVCIGTNGRMSVPANR 54 >AF457550-1|AAL68780.1| 92|Anopheles gambiae antigen 5-related 3 protein protein. Length = 92 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 295 SQYSHNGCPTLQTETHYCFTAEIG 224 SQ+ NG P L +Y FT +G Sbjct: 34 SQWPENGNPYLYLVCNYSFTDIVG 57 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 22.2 bits (45), Expect = 7.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 222 GRWYLPVQTHKRS 184 GRW L +TH++S Sbjct: 791 GRWVLDKETHRKS 803 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,331 Number of Sequences: 2352 Number of extensions: 8890 Number of successful extensions: 29 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -