BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0032 (425 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97017-1|AAB52363.1| 2643|Caenorhabditis elegans Temporarily ass... 27 5.6 Z73098-8|CAA97334.2| 303|Caenorhabditis elegans Hypothetical pr... 26 9.8 >U97017-1|AAB52363.1| 2643|Caenorhabditis elegans Temporarily assigned gene nameprotein 162 protein. Length = 2643 Score = 27.1 bits (57), Expect = 5.6 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -1 Query: 164 NYNFAGLIFIARCYSFTVEVNREHLLSTYFIRKIGTRQRDSNTS 33 NY GL I C + ++L T RKI T QR SN S Sbjct: 661 NYTVHGLTGIMNCEGMAYDFTSDNLYMTDQRRKIITVQRLSNLS 704 >Z73098-8|CAA97334.2| 303|Caenorhabditis elegans Hypothetical protein T21C9.7 protein. Length = 303 Score = 26.2 bits (55), Expect = 9.8 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 271 PTLQTETHYCFTAEIGGAVVPTRADSQEVLPPVITQIII 155 P ++ ++ +GG T A+S EVL ++T +I+ Sbjct: 149 PIATNNAYFIYSPTLGGFATKTVANSTEVLNSLVTFMIV 187 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,659,589 Number of Sequences: 27780 Number of extensions: 209364 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 703342068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -