BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0029 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding pr... 26 0.95 AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding pr... 26 0.95 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.2 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 25 2.2 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 2.9 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 24 5.0 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 8.8 >AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding protein AgamOBP7 protein. Length = 154 Score = 26.2 bits (55), Expect = 0.95 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 53 DSKNSEVVKKEIDAVLPTDVKVTTEHITKE--QIVSP 157 D ++ + ++P DVK +H+T+E IV+P Sbjct: 88 DEATGRILLDRLLYIIPDDVKAAVDHLTRECSHIVTP 124 >AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 26.2 bits (55), Expect = 0.95 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 53 DSKNSEVVKKEIDAVLPTDVKVTTEHITKE--QIVSP 157 D ++ + ++P DVK +H+T+E IV+P Sbjct: 88 DEATGRILLDRLLYIIPDDVKAAVDHLTRECSHIVTP 124 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 320 TDSSSLSHYVDLPKSPLADSPKPTEE 397 TDS S PK+P ADS KP E Sbjct: 1334 TDSPLFSRRNRQPKAPDADSSKPQSE 1359 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 25.0 bits (52), Expect = 2.2 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = +2 Query: 14 KPKVQLDLTVQEFDSKNSEVVKKEIDAVLPTDVKVTTEHITKEQIVSPVIEKESRIENKA 193 KP+ +D Q E+ + + V P D EH+ +EQ ++E E+++ Sbjct: 42 KPEAPVDDAEQPLPPNGDELPEDAPEPV-PEDGSPDEEHLEEEQEEEAEADEEEADESES 100 Query: 194 EE 199 EE Sbjct: 101 EE 102 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.6 bits (51), Expect = 2.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 115 SNYRTHYKRTNCIS 156 SN R+HYKR C S Sbjct: 170 SNQRSHYKRIQCYS 183 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 323 DSSSLSHYVDLPKSPLADSPKPTEELLE 406 D ++ LP P ADS KPT++ ++ Sbjct: 27 DEENVVQAEQLPILPTADSSKPTDDTVK 54 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 17 PKVQLDLTVQEFDSKNSEVV 76 P V DLTV+E+ K +E+V Sbjct: 91 PPVGSDLTVEEYKRKWTEIV 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,475 Number of Sequences: 2352 Number of extensions: 7516 Number of successful extensions: 15 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -