BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0028 (687 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 40 0.075 UniRef50_Q4P4E9 Cluster: Putative uncharacterized protein; n=1; ... 33 4.9 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 39.5 bits (88), Expect = 0.075 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 209 VSFFFFLMWLDELTAHLVLTGY*SP 135 +S F L W+DELTAHLVL+GY SP Sbjct: 151 LSRFLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_Q4P4E9 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1698 Score = 33.5 bits (73), Expect = 4.9 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 242 FHVLSCFW*RFDEFHSAQASCSFCELILNASFNSKPEPV 358 +H W R D+F + A+ +FCE L+ SF+S+ P+ Sbjct: 1021 YHAAIDEWMRDDQFDRSPATTTFCEPFLSPSFSSRDSPL 1059 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,008,081 Number of Sequences: 1657284 Number of extensions: 13383507 Number of successful extensions: 30734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30729 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -