BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0028 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1109 + 26151421-26153601 30 2.0 11_06_0184 - 21006659-21009823 28 6.0 06_01_0785 - 5873244-5873357,5873458-5873562,5874333-5874424,587... 28 8.0 01_06_1718 - 39408179-39408427,39409102-39409217,39409460-394096... 28 8.0 >12_02_1109 + 26151421-26153601 Length = 726 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = -1 Query: 633 LVIKDLKLMSEKFSSGDRHIESHSVGRALTRRSDDLLHVSQDRL 502 L+++ +L S ++G+ ES SVGRA+ R DDL S+ RL Sbjct: 19 LLLQPRRLCSSA-TAGELASESASVGRAVYRVDDDLAEESRSRL 61 >11_06_0184 - 21006659-21009823 Length = 1054 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -2 Query: 638 NSWSLKILNS*AKNSRLVTAILKVIAWVGLSQGGPTTCCMSHR 510 NS K LNS + +SRL+ +L + GL G T C H+ Sbjct: 690 NSNIKKFLNSLSSSSRLLLTVLDLEGRKGLKAGDLHTVCKIHK 732 >06_01_0785 - 5873244-5873357,5873458-5873562,5874333-5874424, 5874525-5874594,5875080-5875202,5875287-5875372, 5875547-5875648,5875874-5876096,5876217-5876282, 5876407-5876497,5876574-5876701,5877734-5877749, 5878171-5878318,5878440-5878511,5878586-5878690, 5879122-5879291,5880093-5880424 Length = 680 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 324 KISSQNEQLAWAEWNSSNLYQKHDSTWKG 238 +I N+++AW EW+ N+ W G Sbjct: 242 RIDHNNKRMAWIEWSHPNMPWDKSELWVG 270 >01_06_1718 - 39408179-39408427,39409102-39409217,39409460-39409603, 39409700-39410930,39411213-39411494 Length = 673 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 228 CVSCPSTCCRASGKGSTSSIRPRP 299 CV C C R G S+SS + RP Sbjct: 52 CVDCTKRCIRIHGMASSSSEKARP 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,504,809 Number of Sequences: 37544 Number of extensions: 383158 Number of successful extensions: 842 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -