BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0027 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 25 0.43 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 25 0.57 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 24 1.3 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 7.1 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 9.3 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 25.4 bits (53), Expect = 0.43 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +3 Query: 492 RFEGRGSRCNYTETLQLISQGGWRI 566 ++ G Y E ++L +GGW++ Sbjct: 289 KYTGEAGMLGYNEIVELQKEGGWKV 313 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 25.0 bits (52), Expect = 0.57 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 433 LTRGPTTSKYQTVVSNIKLLMSTPNE 356 +T+ TSK Q +V NI+ +S PN+ Sbjct: 111 VTKTSETSKLQQLVDNIEHKLSDPNQ 136 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.8 bits (49), Expect = 1.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 499 SNRNAVLLHDRNRQGGGTYSRGLTRGPTTSKYQTVVSN 386 + + AV L+DR +Q GT + + KY VV+N Sbjct: 274 TRKQAVTLNDRVKQVAGTLIIREAKVEDSGKYLCVVNN 311 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 486 AFRFEGRGSRCNYTETLQLISQGGW 560 A R+ G Y E ++ + GGW Sbjct: 291 AGRYTGERGMMGYNEIVEAQNAGGW 315 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 433 DRASTYHHPAYFC 471 DRAS YH+ A C Sbjct: 193 DRASGYHYNALTC 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,452 Number of Sequences: 336 Number of extensions: 3625 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -