BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0027 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical pr... 28 7.1 U88184-3|AAK31519.1| 648|Caenorhabditis elegans Hypothetical pr... 28 7.1 >Z81091-5|CAB03142.1| 768|Caenorhabditis elegans Hypothetical protein F55H12.1 protein. Length = 768 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -2 Query: 617 SPPGVKWLLEPIGIYDLDAPPTLRYKL*GLSIVTTAAPPFKPKRSSASRQK 465 +P K + P + APPT+R + ++ TT APP S S K Sbjct: 3 TPVSTKKTIAPSTMKTTVAPPTMRTTMAPTTMKTTVAPPTMKTTRSPSTMK 53 >U88184-3|AAK31519.1| 648|Caenorhabditis elegans Hypothetical protein F36H5.8 protein. Length = 648 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -3 Query: 493 RNAVLLHDRNRQGGGTYSRGLTRGPTTSKYQTVVSNIKLLMST 365 R+ + LH + + GTYSR + + S T+V +++L+ +T Sbjct: 458 RSLIGLHIKTLELKGTYSRSIQLFGSLSNVDTIVLDVELVQTT 500 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,513,816 Number of Sequences: 27780 Number of extensions: 325083 Number of successful extensions: 643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -